(data stored in ACNUC7421 zone)

EMBL: AK140990

ID   AK140990; SV 1; linear; mRNA; HTC; MUS; 3203 BP.
XX
AC   AK140990;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130093B14 product:DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3,
DE   X-linked, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3203
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 48e83c3c0c98bf89b9cf579f01fc278b.
DR   Ensembl-Gn; ENSMUSG00000000787; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035571; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035549; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035542; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035380; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035327; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035462; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036083; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034686; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000804; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095689; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095693; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096214; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095870; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095387; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095408; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096545; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094252; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130093B14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3203
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130093B14"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        93..2081
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3,
FT                   X-linked (MGD|MGI:103064 GB|NM_010028, evidence: BLASTN,
FT                   99%, match=3185)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TQX5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQX5"
FT                   /protein_id="BAE24540.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRN
FT                   REATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDY
FT                   DGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKY
FT                   DDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
FT                   CAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQ
FT                   IYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDF
FT                   CKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDE
FT                   YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLE
FT                   DFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFD
FT                   LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAF
FT                   EHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFG
FT                   GGGYGGFYNSDGYGGNYNSQGVDWWGN"
XX
SQ   Sequence 3203 BP; 939 A; 592 C; 806 G; 866 T; 0 other;
     gaaagccgca gttctcccgt gagagggcct ttgcggtaga ggcagccttt gctcagcagc        60
     ggaagactcc gatttctcgg tactcttcag ggatgagtca tgtggcagtg gaaaatgcgc       120
     tcgggctgga ccagcagttt gctggcctag acctgaactc ttcagataat cagagtggag       180
     gaagtacagc aagcaaaggg cgttatatcc cacctcattt aaggaacaga gaagctacta       240
     aaggattcta tgacaaagac agttcagggt ggagttctag taaagataag gatgcataca       300
     gcagttttgg atcacggggt gattcaagag ggaagtctag cttctttgga gatcgtggaa       360
     gtggatcaag gggaaggttt gatgatcgtg gacggggaga ctatgatggc attggtggcc       420
     gtggagatag aagtggcttt ggcaaatttg aaagaggtgg aaatagtcgc tggtgtgaca       480
     aatcagatga agatgactgg tcaaagccac tcccaccaag tgaacgattg gaacaggaac       540
     tcttttctgg aggcaatact gggattaact ttgagaaata tgatgacatt ccagtcgaag       600
     caacaggcaa caactgtcct ccacacattg aaagtttcag tgatgtcgag atgggagaaa       660
     ttattatggg aaacattgag cttactcgtt atactcgccc aactccagtg cagaagcatg       720
     ctattcctat tatcaaagag aaaagagact tgatggcttg tgctcaaaca ggctctggaa       780
     aaactgcagc atttctcttg cccatcttga gtcagatcta tgctgatggt ccaggagaag       840
     ctctgagggc tatgaaggaa aatggaagat atggccgtcg taaacagtat ccaatctctt       900
     tggtactggc accaacgaga gaattggcag tgcagatcta tgaggaagcc agaaaattct       960
     cataccgatc tagagtccgt ccttgcgtgg tttatggtgg tgctgaaatt ggccagcaga      1020
     ttcgagactt agaacgtgga tgccacttgt tagtagccac tccaggacgt ctagtggata      1080
     tgatggagag agggaagatc gggttagact tctgcaaata cctggtgtta gatgaagctg      1140
     accggatgtt agatatgggg tttgaacctc agatacgaag aatagttgaa caagacacta      1200
     tgcctccaaa aggtgtccgc cacactatga tgtttagtgc tacttttcct aaggaaatac      1260
     agatgctggc ccgtgatttc ttagatgagt acatatttct ggctgtagga agagttgggt      1320
     ctacttcaga gaacatcaca caaaaagtgg tttgggtgga ggagatagac aaaaggtcat      1380
     ttctgcttga ccttctaaat gcaacaggca aggattccct gactctagtg tttgtggaga      1440
     caaaaaaggg ggcagattcg ctggaggatt tcttatacca tgaaggatat gcttgtacca      1500
     gtatccatgg agaccgttct cagagagata gggaagaggc ccttcaccag ttccgctcag      1560
     gaaaaagccc aattctagtg gctacagcag tagcagcaag aggactggat atttcaaatg      1620
     tgaagcatgt tattaatttt gacctgccta gtgatatcga agaatatgtg catcgcatag      1680
     gccgtacagg ccgtgtggga aaccttggtc ttgccacctc attctttaat gaaaggaata      1740
     taaatatcac aaaggattta ctggatcttc ttgttgaagc aaaacaagaa gtgccttctt      1800
     ggttagagaa catggctttt gaacaccact acaagggtag cagtcgtgga cgttctaaga      1860
     gcagtcgatt tagtggaggg tttggtgcca gagactaccg acagagtagc ggtgccagca      1920
     gttccagctt cagcagcagc cgtgcaagca gcagtcgaag tggtggaggt ggccatggcg      1980
     gcagtcgagg atttggtgga ggtggctacg gaggctttta caacagtgat ggatatggag      2040
     ggaattataa ctcccagggg gttgactggt ggggtaactg agcctgctct gtagtaggtc      2100
     accctgccaa acaagctaat atggaaacca catgtaactt agccagacta taccttgtgt      2160
     agcttcaaga actcgcagta cattaccagc tgtgattctc cactgaaatt ttttttttaa      2220
     gggagctcaa ggtcacaagt aaagatgaaa ggaacaatca gcagccctgt ctgaaggtgg      2280
     tttgaagact tcattgctgt agtttggatt aacgcccctc ccgcctaccc ctatcccaaa      2340
     ctgcatttat aattttgtga ctgaggatca tttgtttgtt aatgtactgt gcctttaact      2400
     ttagacaact ttttattttg atgtcctgtt ggctcagtaa tgctcaagat tccaattgtt      2460
     tttgacaaaa taaatttact gaacttgggc taaaatcaaa ccttggcaca caggtgtgat      2520
     acaacttaac aggaatcatc gattcatcca taaataatat aaggaaaaac tcaagtggta      2580
     gcctgtctta aggcttttga tacttgcaga ttggggaaaa acaaacaaca aacgtcttga      2640
     agcatattaa tggaattagt ttctaatgtg gcaaactgta ttaagttaaa agttctgatt      2700
     tgctcactct atcctggata ggtatttaga acctgataat agtctttaaa caagccattc      2760
     cagtcatgat gaggtgatgt atggatacat gcatacattc aaagcactgt tctcaaagtt      2820
     aatgcaagta aatacagcaa ttcctctttc aatgtttagg cagatcgtta actatgagct      2880
     agccaaatgt gggcatgtta ttacagggaa agtttaaagg tctgataact tgaaataggt      2940
     ttaggagaat tcatctactt agacttttta aatgcctgcc ataaaaaatt gaaatggtag      3000
     aatggctgac cacagcaatg accagccctc acctagggct ctggatgatt tttggtctaa      3060
     taacgcatgc tagtgttgat gttttttggt caagatggga atgaacagga agaattatgc      3120
     agcaggcttt attttaaatg ccgattcaca ttactctgtt caagctgcgt tgagatgtta      3180
     aactggctta ctatagactt tgg                                              3203
//

If you have problems or comments...

PBIL Back to PBIL home page