(data stored in ACNUC9306 zone)

EMBL: AK145707

ID   AK145707; SV 1; linear; mRNA; HTC; MUS; 2927 BP.
XX
AC   AK145707;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus blastocyst blastocyst cDNA, RIKEN full-length enriched
DE   library, clone:I1C0031O10 product:villin 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2927
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e1de38d2064096c9479888595cb2012d.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I1C0031O10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2927
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="blastocyst"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I1C0031O10"
FT                   /cell_type="blastocyst"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        139..1899
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="villin 2 (MGD|MGI:98931 GB|BC048181, evidence:
FT                   BLASTN, 99%, match=2889)"
FT                   /db_xref="GOA:Q3UL48"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:98931"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UL48"
FT                   /protein_id="BAE26602.1"
FT                   /translation="MAKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKDGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQM
FT                   LREKEELMLRLQDYEQKTKRAEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRA
FT                   KEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVK
FT                   TKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNT
FT                   KQRIDEFEAM"
FT   regulatory      2909..2914
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2927
FT                   /note="putative"
XX
SQ   Sequence 2927 BP; 791 A; 738 C; 813 G; 585 T; 0 other;
     gatactcggg actgcggagc gcgcgcaggg cttccctccg cctgcaggtc ccgacgcgtc        60
     tccgccgtcg ccgtcgccgt cgcctccgcc gtacagccga atagccgagg acccacgcag       120
     agccaccaac cagccaagat ggccaagcca atcaacgtcc gggtgaccac catggatgcc       180
     gagctggagt ttgccatcca gccaaacacc accgggaagc agctctttga tcaggtggta       240
     aagacgattg gcctccggga agtgtggtac ttcggcctcc agtatgtaga caataaagga       300
     tttcctacct ggctgaaact tgataaaaag gtctccgcac aggaggtccg aaaggagaac       360
     cctgtccagt ttaaattccg ggccaagttc taccccgaag acgtggccga ggaactcatc       420
     caggacatca cacagaagct cttcttcctg caagtcaagg acgggatcct cagcgacgag       480
     atctactgcc ccccagagac agccgtgctc ctgggctcct atgccgttca ggccaagttc       540
     ggagattata acaaggaaat gcacaagtct gggtacctca gctcggagcg gctgatcccc       600
     cagagagtca tggaccaaca caagctcagc agggaccagt gggaggaccg gatccaggtg       660
     tggcacgcgg aacaccgagg gatgctcaag gacagtgcta tgctagaata cctgaagatt       720
     gcccaggacc tggaaatgta tgggatcaac tatttcgaga tcaaaaacaa gaaaggaaca       780
     gacctttggc ttggagtcga tgcccttgga cttaacattt atgagaaaga tgacaagttg       840
     accccaaaga tcggcttccc ttggagtgag atcaggaaca tctctttcaa cgacaagaag       900
     tttgtcatta agcccatcga caagaaggca cctgactttg tgttctacgc cccgcgcctg       960
     agaattaaca agcggatcct gcagctctgc atggggaacc atgagctgta catgcgccgc      1020
     aggaagcccg acaccatcga ggtgcagcag atgaaggccc aggctcggga ggagaagcac      1080
     cagaagcagc tagagcgaca gcagttggaa accgagaaga agaggcgaga gacggtggag      1140
     agagaaaagg agcagatgct ccgggagaag gaggagctga tgcttcggct gcaggactac      1200
     gagcagaaga ccaagagggc ggagaaagag ctctccgagc agattgagaa ggccctccaa      1260
     ctggaggaag agaggaggcg agcccaggag gaggctgaac gtctggaggc cgaccgcatg      1320
     gccgccctgc gggccaagga agaactcgag agacaggcgc aggatcagat aaagagccag      1380
     gagcagctgg ctgcagagct ggcagagtac acggccaaga tcgcactgct ggaggaggcg      1440
     cggaggcgca aggaggacga ggtagaagag tggcagcacc gggctaaaga agcccaggac      1500
     gacctggtga agaccaaaga ggagctgcac ctggtgatga cggccccacc gcccccaccg      1560
     cccccagtgt atgagcctgt gaattaccac gtgcaggagg gactgcagga cgagggagca      1620
     gagcctatgg gctacagtgc cgagctctcc agtgagggca tcctggatga ccgcaacgag      1680
     gagaagcgga tcacagaggc agagaagaat gagcgcgtgc agcggcagct gctgaccctg      1740
     agcaatgagt tgtcccaggc ccgggatgag aacaagagga cccacaatga catcatccac      1800
     aacgagaaca tgcggcaagg cagggacaag tataagacgc tgcggcaaat caggcagggc      1860
     aacaccaagc aacgcattga cgagttcgag gccatgtaga ggccaggctg ggaccaaggg      1920
     cagagggcac ctcactgcag gcaggtgtca cacttggctc tttagttctc ttaagtttag      1980
     acaccccctt gctgtgttcc agtcccttaa agagcagtta cggggcctgc attctgcccc      2040
     gagacccagt gggctcctcc ttggttcctt ctaattgtat cacatagtgc caaacaggtc      2100
     agatttaatg acagttaccg aatcacttcc tgtttggagc agggattcgg agggctggcc      2160
     ctcatgaagc aagattcatt gtcactggga cagcactgtg gctcacgggt gccatacttt      2220
     tctctagttt tacaatgagc tcaaatcgat tttgttcttg atttttatga aggatccatc      2280
     tctgtgtatt gaggggtaaa aatgattttg aaatttgagt ctaaagcatg cccccacaga      2340
     gtctccttcc tccagaccgc tggcagagtc tccaggggtc cttcagagtg tacggtacag      2400
     gactctccga tacaaaattc tcatgcttat ctgttagcat acattgttgg acttatatat      2460
     ctaatgatct gctatagagg atagtattta tatataagcg ataatatggg tttgtaacat      2520
     tagttttaaa aaagggaaag ttttgttctg tatattttgt taccttttac agaataaaag      2580
     aattcaacat taagaaccat gtaaccgaga cacttgatct gacacagggg cagtcgggaa      2640
     accgatgact gcagtaatca ccactgtaca aaaatgttag tgggttttgt gcacgtaaaa      2700
     tgcacacttc catttcctgt cagtttctta tttgaaaaaa aaaaaataca caccgagagc      2760
     atccagactc cagccctgaa gggacgccgg cctctttatt gtgagcaact tgttcccgtt      2820
     ttcagtttgt cttccttcct ttcgcggact agcctccttg gttgtgatgt ctgtcctgtg      2880
     cgggtgactc cgcaccagat ttacacacaa taaaagctct ccaaggc                    2927
//

If you have problems or comments...

PBIL Back to PBIL home page