(data stored in ACNUC32233 zone)

EMBL: AK147671

ID   AK147671; SV 1; linear; mRNA; HTC; MUS; 8252 BP.
XX
AC   AK147671;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus adult male brain UNDEFINED_CELL_LINE cDNA, RIKEN full-length
DE   enriched library, clone:M5C1106A14 product:spectrin beta 3, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8252
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 436ddf7ad9d29ffbe257a366115d50bd.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=M5C1106A14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8252
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="M5C1106A14"
FT                   /cell_line="UNDEFINED_CELL_LINE"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        461..7627
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="spectrin beta 3 (MGD|MGI:1313261 GB|AF026489,
FT                   evidence: BLASTN, 100%, match=671)"
FT                   /db_xref="GOA:Q3UGZ4"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1313261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGZ4"
FT                   /protein_id="BAE28063.1"
FT                   /translation="MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFER
FT                   SRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLP
FT                   KPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQ
FT                   DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDL
FT                   LDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFS
FT                   KMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGV
FT                   QNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAW
FT                   ERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELA
FT                   AVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLR
FT                   QMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELV
FT                   EADIAVQAERVRAVSASALRFCDPGKEYRPCDPQLVSERVATLEQSYEALCELAATRRA
FT                   RLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRL
FT                   GPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQQLAQAASLYQFQ
FT                   ADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAA
FT                   LPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEK
FT                   EQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVNDIAEQLLKASPPGKDRII
FT                   GTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGN
FT                   DLAGVLALQRKLAGTDRDLEPISARVGELTQEANALAAGHPAQAPAINTRLGEVQAGWE
FT                   DLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQH
FT                   AALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQG
FT                   RLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANG
FT                   ERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFL
FT                   QDCQELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGREL
FT                   TLEKPELKVVVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESL
FT                   QAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAQALAQEDQSAGEVER
FT                   TSRAVEEKFRALCQPMKERCRRLHASREQHQFHRDVEDEILWVTERLPMASSLEHGKDL
FT                   PSVQLLMKKNQTLQKEIQGHEPRIADLKERQRTLGTAAAGPELAELQEMWKRLSHELEL
FT                   RGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALA
FT                   DYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLC
FT                   QLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANA
FT                   LANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALA
FT                   RVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDK
FT                   AEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQ
FT                   ERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQ
FT                   SRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESL
FT                   IKRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQPPTSEPMASQPEG
FT                   SLVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLEQQRLEQSNVPEGPGS
FT                   GTGDESSGPRGERQTLPRGPAPSPMPQSRSSEAAHGATLPTRGPELSAQEQMEGMLCRK
FT                   QEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVPYHGEVPVSLARAQGSVAF
FT                   DYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSAPGESEEPVVPSAS
FT                   RGLTRAMTMPPVSQPEGSIVLRSKDGREREREKRFSFFKKNK"
FT   regulatory      8232..8237
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      8252
FT                   /note="putative"
XX
SQ   Sequence 8252 BP; 2025 A; 2233 C; 2548 G; 1446 T; 0 other;
     ggtgcgtttg ctctgatttg ggcatatttc cttcctctcc taggcagata gcagctcacc        60
     ttggttaatg ccattaaacc gtagaccact cagctgctaa taaaccagga agaaacccgg       120
     ccgtgctagg actagaaatg tccatccctg cccccaaccc ccttaagaca gtgactaggc       180
     cggaattctc ctggttgata aatgagagga gctgaggagc cgctgtgatg acggttccga       240
     gaatctgatt tgtgagaagg cgaatctcca ggagcaccat ggagatgctt ttggaaagcg       300
     ggccagccta cctgccagaa ggaggacgag agaaaggggg caaggcagag agaaacgctt       360
     aagcgagatg gcctggaggt gccccaaaag ggacctttga aaaggaaacg gaggccgcat       420
     ctcggggaaa cctcggagga acaggaagcc acccaccacc atgagcagca ctctgtcacc       480
     cactgacttt gacagcttgg agatccaggg ccagtacagt gacatcaaca accgctggga       540
     cctgcctgac tcagactggg acaatgacag cagttcggcc cgcctctttg agaggtccag       600
     gatcaaggcc ctggcagatg agcgagaagc cgtgcagaag aaaaccttca ccaagtgggt       660
     gaactcccac ctggcccggg tgacatgccg ggtgggagac ctgtacagcg acctgcggga       720
     cgggcgcaac ctcctgaggc tcctggaggt gctctcggga gagaccctgc caaaacctac       780
     caagggccga atgcggattc actgcctgga gaatgtagat aaagcgctgc agttcctgaa       840
     ggagcagaag gtgcacttgg aaaacatggg ctcccatgac attgtggacg gaaaccaccg       900
     tctgaccctt gggctagtgt ggaccatcat cctccgattt cagatccaag acatcagtgt       960
     ggagacagaa gacaacaagg agaagaagtc agccaaggat gccctgctgc tgtggtgcca      1020
     gatgaagact gcaggatacc ccaatgtcaa tgtgcacaac tttaccacca gttggagaga      1080
     tgggctggcc tttaatgcca ttgtgcacaa acaccggcca gacctgttgg attttgagtc      1140
     cctgaagaag tgtaatgcac actacaatct gcagaatgct ttcaatctgg ctgaaaagga      1200
     acttggcctg acgaagctcc tggatcctga agatgtgaat gtagaccagc ccgacgagaa      1260
     gtctatcatc acctacgtgg ccacttacta ccactacttc tccaagatga aggccctggc      1320
     tgtggaaggc aaaagaattg gcaaggtcct agaccatgcc atggaggcag aacacctggt      1380
     agagaaatac gagtccctgg cctctgaact gctgcagtgg attgagcaaa cgatcgtgac      1440
     cctcaatgac cgacagctgg ccaactccct gagtggagtc cagaaccagc tgcagtcttt      1500
     caactcctat cgcactgtgg agaagccacc caagttcacg gagaaaggga acttggaggt      1560
     gttgctcttc accatccaga gcaagctacg ggccaacaac cagaaggtct acacaccccg      1620
     ggaaggccgg ctcatctcgg acatcaacaa ggcctgggag cggctggaga aagccgaaca      1680
     tgagcgagag ctagcgctgc gcacagagct gatccgccag gagaagctgg agcaactggc      1740
     tgctcgcttc gaccgcaagg ctgccatgcg ggagacctgg ctcagtgaga accagcgact      1800
     tgtgtcccag gacaactttg ggctggaact ggcagcagtg gaggctgcag tgagaaagca      1860
     tgaagccatt gagacagaca ttgtcgccta cagtggccgg gtgcaggcgg tggatgctgt      1920
     agctgcagaa ctggctgctg agcactacca tgacattaag cgcattgcgg cacgtcagaa      1980
     caacgtggcc cggctctggg acttcttacg gcaaatggtg gctgcccgcc gtgagagact      2040
     tcttctcaac ctggagctgc agaaagtgtt tcaggacctg ctctacctca tggactggat      2100
     ggcagagatg aagggccgac tgcagtctca ggacttgggc aagcacctgg ctggagtgga      2160
     ggacctcctg cagctacacg aactggtgga ggcggacatc gcggttcagg ctgagagggt      2220
     tcgagcggtc agcgcctctg ccctgcgttt ctgcgaccca gggaaagagt ataggccatg      2280
     tgacccacag ctggtgtcag agagggtggc cactctggag cagagctatg aggccctgtg      2340
     tgaattggca gcgactagaa gggcccgact ggaagagtca cgtcgtctct ggaggttcct      2400
     ctgggaagtg ggtgaggctg aggcctgggt ccgggagcag cagcacctcc tggcctcagc      2460
     tgatacaggc cgggacctga ctggtgtcct tcgcctgctc aacaagcacg cagccctacg      2520
     gggtgagatg agtggccgtc tggggcccct gaagctcacc ctggagcaag gtcagcagtt      2580
     agtcgctgag ggccaccctg gagccaacca agcctcaacc cgtgcagccg agctccaggc      2640
     ccagtgggag cgactagaag ccctggccga ggagcgagcc cagcagctgg cacaggctgc      2700
     cagcctctac cagttccagg cagatgcaaa tgacatggag gcctggttgg tggatgcact      2760
     gcgcctggta tctagccccg aggtagggca cgacgagttc tccacacagg ccctggccag      2820
     gcagcacagg gcccttgaag aggagatccg agcccaccgg cctacactgg atgccctgag      2880
     ggagcaggct gcagccctgc cacctgcact gagccacaca ccggaggtac agggcagggt      2940
     gcccactctg gagcagcact atgaggagct gcaggcccga gccggtgagc gtgcacgagc      3000
     cctggaggca gccctggcgt tctataccat gctcagcgag gctggggcct gtggcctctg      3060
     ggtagaggag aaggagcaat ggctcaacgg gctggcccta cctgagcgcc tggaggacct      3120
     ggaggtggtc cagcagaggt ttgagaccct ggagcctgaa atgaacgccc tggctgcacg      3180
     ggttactgct gtcaatgaca tcgctgagca gctgctgaag gccagtccac caggcaagga      3240
     ccgcatcatt ggcacccagg agcagctcaa ccaaaggtgg cagcagtttc ggtccctggc      3300
     agatggcaaa aaggcggctc tgacatcagc cctgagcatc cagaattacc acctagagtg      3360
     cacagagacc caggcctgga tgagagagaa gactaaggtc attgagtcca cccagggcct      3420
     gggcaatgat ctagctggtg tgctggccct gcagcggaag ttggcgggta ctgacagaga      3480
     tctggaacct atctctgccc gggtgggtga gctgacccaa gaggcaaatg ccttggctgc      3540
     tgggcaccca gctcaagccc ctgccatcaa cacccggctt ggagaggtac aagcaggatg      3600
     ggaagatctt cgggcgacca tgaggcggag agaagagtcc ctgggtgagg ctcggcggct      3660
     gcaggatttc ctgcgcagct tggatgactt ccaggcctgg ctaggccgca cacagaccgc      3720
     tgtagcctcc gaagaagggc cagccaccct tcccgaggca gaagccctct tagcccagca      3780
     cgcagctctg cggggagaag tggagagagc ccagagcgag tacagccgcc tcaggacctt      3840
     gggcgaggag gtgaccagag accaggctga tccccagtgc ctcttcctca gacagaggct      3900
     ggaagccctt ggaaccggct gggaggagct gggtcgcatg tgggagagcc ggcaaggccg      3960
     cctggcccag gcccatggct tccaggggtt tttaagagat gctcgccagg ctgagggtgt      4020
     tctcagcagc caggaatatg tcttgtctca cacggagatg ccagggacac tgcaggcggc      4080
     agatgcagcc attaaaaagc tggaagactt catgagcact atggacgcca atggagagcg      4140
     catccgcgga ctcctggagg ctggacgtca gctggtgtcc aagggcaata tccatgctga      4200
     gaagatccaa gagaaggcgg actccatcga gaagaggcac agaaagaatc aggaggcggt      4260
     gcagcagctt ttaggacgcc ttcgggacaa ccgagagcag cagcacttct tgcaagactg      4320
     tcaggagctg agactctgga tcgatgagaa gatgctgaca gctcaggatg tgtcctatga      4380
     cgaagctcgc aacctgcaca ccaagtggca gaaacaccag gcattcatgg ccgagcttgc      4440
     agccaacaag gactggctgg acaaagtgga caaggaaggg cgggagctga ctcttgaaaa      4500
     gccagaactc aaagtcgtag tgtcagagaa gctggaggac ctgcaccggc gctgggatga      4560
     actggagacc actacccaag ccaaggcccg cagtcttttt gatgccaacc gggcagagct      4620
     atttgctcaa agctgttctg ccctggagag ctggctggag agcctgcagg cccagctgca      4680
     ctcagatgac tatggcaaag acctcaccag tgtcaacatt ctgctgaaga agcaacagat      4740
     gctggaacga gagatggctg tgagagagaa ggaggtagag gcgatacagg cccaggccca      4800
     ggccctggcc caggaagacc agagtgcagg ggaggtagaa aggacctcaa gggctgtgga      4860
     ggagaagttc agggccttgt gtcaacccat gaaagaacgc tgccggcgcc tgcacgcctc      4920
     ccgggagcag caccagttcc accgggatgt ggaggatgag atattgtggg tgactgagcg      4980
     gcttcccatg gccagctctc tggaacatgg caaggacttg cccagtgtcc agcttctcat      5040
     gaagaaaaac cagaccctgc agaaggagat ccagggccat gagccccgga ttgcagacct      5100
     caaagagagg cagcgcactc tgggaacagc agcagcaggt ccagagctgg ctgagctcca      5160
     agaaatgtgg aaacgcctga gccatgagct ggagcttcgg ggcaagcggc tggaggaagc      5220
     tcttcgagcc cagcaattct atcgtgatgc tgcagaggcc gaggcttgga tgggtgagca      5280
     ggagttacac atgatgggcc aggaaaaggc caaggatgag ctgagcgccc aggcagaagt      5340
     gaagaagcat caggtattgg aacaagccct tgctgactat gcccagacca tcaaacaact      5400
     agcagccagc agtcaagata tgattgacca tgaacatcca gagagcacaa gactaacaat      5460
     acgccaagcc caggtggaca agctgtacgc cagcctgaag gagctggcag gagagcggcg      5520
     cgagcgcctg caggagcacc tccggctgtg ccagctccgc agagagctgg atgacctgga      5580
     acagtggata caggagcgtg aagttgtggc agcctcccat gaactgggcc aagactatga      5640
     gcacgtgact atgcttcggg acaaattccg agagttctcc aaggacacca gcaccattgg      5700
     ccaggagcgc gtagacagtg ccaatgcact ggccaatggg ctcattgctg ggggccatgc      5760
     tgcacgggcc actgtggccg agtggaagga cagtctcaat gaggcctggg ctgacctgct      5820
     ggagctgctg gacacaagag gtcaggtgct ggctgctgcg tatgagctgc agcgcttcct      5880
     gcatggagcc cgccaagccc tggcacgggt acagcacaag cagcagcagc ttccagacgg      5940
     gactggccgt gacctcaatg ctgctgaggc cctgcagcgc cggcactgtg cctatgagca      6000
     cgacatccaa gccctcagca ctcaggtcca gcaagttcaa gatgatggcc aaaggctaca      6060
     gaaggcctat gctggagaca aggctgagga aattggccgt cacatgcagg cagtggctga      6120
     ggcctgggcc cagctccagg gaagttctgc tgcccgccga cagctgttac tggataccac      6180
     ggacaaattc cgattcttta aggctgtccg agagttgatg ctgtggatgg atgggattaa      6240
     cctgcagatg gatgcccagg agcggccccg ggatgtgtcc tctgcagatt tagtcatcaa      6300
     aaaccaacaa ggaatcaaag cagagataga ggccagagca gacaggttct cctcctgcat      6360
     tgacatgggg caggagctgc tggcccggag ccactatgct gctgaggaga tctcagagaa      6420
     gctgtctcag ctacagtccc ggcgccagga gacagctgac aagtggcagg agaagatgga      6480
     ctggctacag cttgttttgg aggtgcttgt gtttgggaga gatgcaggga tggcggaggc      6540
     ctggctgtgc agtcaggagc cattggtgcg aagtgcagaa ctgggttgca ctgtggacga      6600
     agtagagagc ctcatcaagc gacacgaagc ctttcagaag tcggccgtgg cctgggaaga      6660
     gcgtttcagt gcgctggaga agctcactgc gctggaagag cgggaaaatg agcggaaaag      6720
     gaagagggag gaggaggaac ggaggaaaca gcctcctact tcagagccca tggctagtca      6780
     gccagaaggg agtctggtag atggccagag agttcctgac actgcctggg atgggactca      6840
     gtcaaaattg ccaccatcca cacaagcacc cagtgttaat ggggtctgca cggacaccga      6900
     ctcctcacag cccctgttgg aacagcagag acttgaacag agcaatgtcc ccgaaggacc      6960
     tggatctggc acaggagacg agtccagtgg gccccgggga gagaggcaga ccctgccccg      7020
     gggccctgct ccttctccaa tgccccagag cagatcatct gaagcagctc atggtgccac      7080
     cctgcccaca cgaggacctg agctctctgc tcaggaacag atggaaggga tgctgtgccg      7140
     caaacaagag atggaagcct tcaacaagaa agctgccaac aggtcatggc agaatgtgta      7200
     ctgtgtactt cggcgtggga gcctcggctt ttacaaggat gccagggcag ctagtgcagg      7260
     agtgccctac catggagaag tgcctgtcag cctggccagg gcccagggaa gtgtggcctt      7320
     tgattatcgg aaacgcaaac atgttttcaa gctgggctta caggatggca aagaatacct      7380
     attccaggcc aaggacgagg cagagatgag ctcatggctg agagtggtga atgcagccat      7440
     tgccactgca tcctctgccc ctggagagtc agaagagcca gtggtgccca gtgccagccg      7500
     gggtctgacc cgggccatga ccatgccccc agtgtcacag cctgagggtt ccatcgtgct      7560
     tcgaagcaag gatggcagag aaagagagcg agaaaaacga ttcagcttct ttaagaagaa      7620
     caagtagtcg gggcaagact cccaggccag ctccctccct ctgttcagaa aactgccagg      7680
     gactgtcgac agagaccacc ctcttggcag gacaactgcc tgctgctagg gtctgctgct      7740
     aaggtcaacc catcaccagg aactgtcact ggggacaaaa gagtgttccc acaaccttct      7800
     cttctgctat ttaattcaac tggtggtggg acccaggcta cccctaatac cacccattcc      7860
     taccttgtca cctcttccca agccttatac ctccacccat ccccccacca tggtgcagat      7920
     agtgccaccc tcaacgtggg ctatgtggga accattgtcc ctgcctcagg gtcattgtgc      7980
     caccacagct agggtgtgcc atccaccatt cagttctttg cctctgggat cagccaggac      8040
     cctcagagct gaagcaggca ggacctgagg gcaggagcgc cagatgatga agtcggaggc      8100
     gctgaagcct tccctgccta tcctgcctca ccctctgact caaggggctg cttgtttcca      8160
     gccactctag gtggctccca agtgtgagtt gttcaggagt agccacatcc ttgagcctat      8220
     ccaaggaggt gattaaacag ctcgacttct ct                                    8252
//

If you have problems or comments...

PBIL Back to PBIL home page