(data stored in ACNUC27125 zone)

EMBL: AK150393

ID   AK150393; SV 1; linear; mRNA; HTC; MUS; 2227 BP.
XX
AC   AK150393;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830006J06 product:protein phosphatase 3, catalytic subunit,
DE   alpha isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2227
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5762ce8414947e49ce477c9481fc1d43.
DR   Ensembl-Gn; ENSMUSG00000028161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056758; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070198; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830006J06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2227
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830006J06"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        138..1673
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform (MGD|MGI:107164 GB|J05479, evidence: BLASTN, 100%,
FT                   match=1414)"
FT                   /note="putative"
FT                   /db_xref="GOA:P63328"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107164"
FT                   /db_xref="PDB:4ORB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63328"
FT                   /protein_id="BAE29521.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKIT
FT                   SFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ"
XX
SQ   Sequence 2227 BP; 626 A; 502 C; 546 G; 553 T; 0 other;
     gagagcccag agctccagcc gagcggtttg cagcgcggcg gcggcggcgc tgagtgtctg        60
     gcccgccggt gcggtcgggg tgtgcagtcg gacgggacga gcagcgcgtc gctgtccccc       120
     cctcccggtg gctggagatg tccgagccca aggcgattga tcccaagttg tcgacgaccg       180
     acagggtggt gaaagccgtt ccatttccac caagtcaccg gctgacagca aaggaagtgt       240
     ttgataatga tgggaaacct cgtgtggata tcttaaaagc acatctcatg aaggagggca       300
     ggctggaaga aagtgttgca ttgagaataa taacagaggg tgcttcgatt ctccgacagg       360
     aaaaaaactt gctggatatc gacgcaccag tcacagtttg tggggacatc catggacaat       420
     tctttgactt gatgaagctc tttgaagtgg gaggatctcc tgccaacact cgctacctct       480
     tcttagggga ctatgttgac agagggtact tcagtatcga atgtgtgctg tatttgtggg       540
     ccttgaaaat tctttacccc aaaacactgt ttttacttcg cggaaaccat gaatgtaggc       600
     acctcacaga gtatttcacg tttaaacaag aatgtaaaat aaagtattca gaacgcgttt       660
     atgacgcctg tatggatgcc ttcgactgcc ttcccctggc tgcgctaatg aaccagcagt       720
     tcctgtgtgt acacggtggt ttgtctccag agattaacac tctagatgac atcagaaaat       780
     tagaccgatt caaagaacca cctgcttatg ggcccatgtg tgacatccta tggtcagacc       840
     ccctggagga ctttggaaat gagaagactc aggaacattt cactcacaac acagtcagag       900
     gctgttcgta cttctacagt tacccagctg tgtgtgactt cctgcagcac aataatttgt       960
     tgtccatact ccgcgcccac gaagcccagg atgcagggta ccgcatgtac aggaaaagcc      1020
     aaacaacagg cttcccgtct ctaattacaa tcttctcggc accaaattac ttagatgtgt      1080
     acaataacaa agctgcagtg ttgaagtacg agaacaatgt gatgaacatc aggcagttca      1140
     actgctcccc gcatccgtac tggctcccaa atttcatgga tgttttcacc tggtcgctgc      1200
     catttgttgg ggagaaagtg actgagatgc tggtcaatgt tctcaacatc tgctccgacg      1260
     atgaactggg gtcagaagaa gatggatttg acggagccac ggccgcagcc cggaaggaag      1320
     tcatcagaaa caagatccga gcaataggca aaatggccag agtgttctca gttctcagag      1380
     aagagagtga gagtgtcctg acactgaagg gcctgacccc aactggcatg ctccccagcg      1440
     gagtgctctc tggcgggaaa cagactctgc aaagcgccat caaaggattt tcaccacaac      1500
     ataagatcac tagcttcgag gaggccaagg gcttagaccg aattaacgag aggatgccac      1560
     ctcgcagaga cgccatgccc tctgacgcca accttaactc catcaacaag gctctcgcct      1620
     cagagactaa cggcacggac agcaatggca gtaatagcag caatatccag tgaccacttc      1680
     ctgttcactt tttttttttt tgagctgcag ggcatgatgg gattgctgca tctcagcagt      1740
     tggatgttct tgcctctgaa ggtagcttgt ttgctctggg ggccaggaat tggattcagt      1800
     ttacactatc atgaaaaata aaaataaaaa aagagggaga gagataataa actatatttt      1860
     ggtgagggtg gtgattaaac acctcttttg ggtatgcctt taaaaaatgc ttctagggaa      1920
     aaaaagtttt aaaaagaaag ctaatgctag tctatactgc aatgttaggg gaatgaacgc      1980
     gttttcctac tgcactgggg acttttagat aggttaatga aaggcctttt attctgttac      2040
     tggacacgaa aactttgtct aatttcttat actctattgt acgtttacag tcgcagcact      2100
     aaaatggaag acatcaaaca tttttaacag aaaaaaaaaa agatgtaaaa actaactaag      2160
     gactatttat tgataatgtt ttgctactcc tgtcagacaa tggctataaa ctgaattagg      2220
     cagtctt                                                                2227
//

If you have problems or comments...

PBIL Back to PBIL home page