(data stored in ACNUC7421 zone)

EMBL: AK153878

ID   AK153878; SV 1; linear; mRNA; HTC; MUS; 1281 BP.
XX
AC   AK153878;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430002A15 product:PP6 homolog [Homo sapiens], full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1281
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e801f697c6eab683b30701c58a118f2c.
DR   Ensembl-Gn; ENSMUSG00000028601; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116309; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0066644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0065658; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430002A15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1281
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430002A15"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..958
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="PP6 homolog [Homo sapiens] (UniProt|Q8WY60,
FT                   evidence: FASTY, 91.1%ID, 100%length, match=405)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3TLP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TLP5"
FT                   /protein_id="BAE32227.1"
FT                   /translation="NYEFSALPRRSRSPRHLAGLLPDATRTAPRAALPCPWRFSGARDC
FT                   ASHATTRTPEIQVQALTGPNQGITEILMNRPHARNALGNVFVSELLEALAQLREDQQVR
FT                   VLLFRSAVKGVFCAGADLKEREQMSDVEVGTFVQRLRGLMSEIAAFPAPTIAAMDGFAL
FT                   GGGLELALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRL
FT                   NGAQARELGLVNHAVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIA
FT                   SGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKFVGK"
FT   regulatory      1261..1266
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1281
FT                   /note="putative"
XX
SQ   Sequence 1281 BP; 277 A; 361 C; 367 G; 276 T; 0 other;
     gaactacgag ttttccgctc tgccgaggag gtcccgttct ccgcgccacc ttgccggcct        60
     gctccccgat gctacgcgta ctgccccgcg cgctgccctc ccgtgcccct ggaggttctc       120
     gggggcccgg gactgcgcct ctcacgcgac gaccaggaca cccgaaatcc aagtgcaggc       180
     tctgacaggt cccaaccaag gaatcactga gattctgatg aacagacctc atgcccgcaa       240
     tgccttgggg aatgtgtttg ttagtgagct gctggaagct ctggcccagc ttcgggaaga       300
     ccagcaagtc cgggtcttgc tcttcagaag tgcggtgaag ggagtgttct gtgcaggtgc       360
     agacctgaag gagcgggagc agatgagtga tgtggaggtg gggacctttg tccagcggct       420
     ccgaggcctg atgagtgaga tcgcagcctt ccctgcgccc accattgcag ccatggatgg       480
     gtttgcctta ggcgggggct tggaacttgc cctggcctgt gacctccgaa tagcagcttc       540
     ttcggctgtc atggggctaa ttgagaccac tcgaggactt ctcccaggag caggagggac       600
     tcagaggctg cctcgctgcc tgggcgtggc cctagcgaag gagctcatct tcacaggccg       660
     gcgactgaac ggggcacagg cccgtgagtt gggcctggta aatcatgccg tggctcagaa       720
     tgaggagggt aacgctgcct accaccgggc cctggcactg gcacaggaga tcctgcccca       780
     ggctcccatt gctgtgcgcc tgggcaaagt tgccatcgac agaggaatgg aggtggacat       840
     tgcatcaggg atggccatag aacagatgtg ctatgcccag aacatcccaa cccaggacag       900
     gctggaagga atggcagcct tcagggagaa acgagctccc aaatttgtgg gcaagtgacc       960
     cagctaactt taagcacaca ccataaagtc tagatcatcc aaagaaccaa ggtactgacc      1020
     atgcagtgca ctgccacctt ccatactgct caccttggct agtgactgga ctctctgcat      1080
     tcaaaaactt cgggtctttg tcattggctc tgatcaccat ggatagagca atgaggactt      1140
     acttactctc acagagtttc tttgagttag tgtcaggagc cctccagctc tctgtaacgc      1200
     aaggggaatt ctggacaaac tatttaacct ctctatcagt ctctctgata tccctgtgtt      1260
     aataaacatg ctgcaactgt t                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page