(data stored in ACNUC1829 zone)

EMBL: AK154466

ID   AK154466; SV 1; linear; mRNA; HTC; MUS; 1238 BP.
XX
AC   AK154466;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630036O22 product:CD37 antigen, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1238
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ae944695a028f22dcee74e3c50322def.
DR   Ensembl-Gn; ENSMUSG00000030798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031246; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031363; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033063; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083753; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083767; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084290; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083880; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082420; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630036O22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1238
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630036O22"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        67..978
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CD37 antigen (MGD|MGI:88330 GB|NM_007645, evidence:
FT                   BLASTN, 99%, match=1114)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U429"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U429"
FT                   /protein_id="BAE32606.1"
FT                   /translation="MDTCEEPIVSLAPTYSKDPQAKMSAQESCLSLIKYFLFVFNLFFF
FT                   VLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKE
FT                   LRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEE
FT                   SWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQ
FT                   LSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGF
FT                   MTLSIFLCRNLDHVYDRLARYR"
FT   regulatory      1218..1223
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1238
FT                   /note="putative"
XX
SQ   Sequence 1238 BP; 229 A; 396 C; 314 G; 299 T; 0 other;
     gcttgcagtc ccaggaccca cgtgagtgga agtccatcag aagcccctgt gcgccctgcc        60
     tgagctatgg acacctgcga ggaacccatt gtgtccctgg cacccacata ttccaaggac       120
     cctcaggcga agatgtccgc ccaagagagt tgcctcagcc tcatcaagta cttcctcttc       180
     gttttcaacc tcttcttctt tgtactaggc ggcctgattt tctgcttcgg cacctggatc       240
     ctcattgaca agaccagctt cgtgtccttt gtgggtttgt ccttcgtgcc actgcagact       300
     tggtccaagg tcctggctgt ctcaggtgtc ctcaccatgg ccctggctct cctgggctgt       360
     gtgggggctc taaaggagct gcgctgtctc ctgggcctgt attttggaat gctgctgctc       420
     ctgtttgcca cacagattac cctgggcatc ctcatttcca ctcagcgggt ccggctggag       480
     cgaagggtgc aggaattggt gttgaggacg atccagagct accgcacgaa tccggatgag       540
     acagcagccg aggagagttg ggactatgca cagttccagc tgcgctgctg cggctggcaa       600
     tctccgcggg actggaacaa ggcccagatg ctgaaagcga acgagtctga ggagcccttt       660
     gtgccctgct cctgctacaa ctccacggcg accaatgact ccaccgtctt tgataagctc       720
     tttttctccc agctaagccg gttggggccg cgggcgaagc tgaggcagac tgctgacata       780
     tgtgcactcc ctgcaaaagc tcacatctac cgtgagggct gcgcgcagag cctccagaag       840
     tggctgcaca acaatatcat ctccatagtg ggaatctgtc tgggagtcgg tcttcttgag       900
     ctcggcttca tgacgctctc aatattcctg tgtagaaatc tggatcacgt ctatgaccgg       960
     ctggcccggt accgctaggc cccagcccac ccatcggcac ccacgcacct ccatgcagtc      1020
     aggaaatgtt tccttcctgg ttggtcacag gcttggagcc catgcctcag gcctcatccc      1080
     ctggggaccc agctgtctgc cctatcgaca gccttcactt tccccacatg gccagggact      1140
     tttgtgccca gcttccttcc cttcctggct ccctcctccc cacaccatct gtctgccacc      1200
     tcccacatga cacctcaaat aaatcccctt tgggtttt                              1238
//

If you have problems or comments...

PBIL Back to PBIL home page