(data stored in ACNUC9543 zone)

EMBL: AK155179

ID   AK155179; SV 1; linear; mRNA; HTC; MUS; 4469 BP.
XX
AC   AK155179;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630206K21 product:calpain 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4469
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ee03aadd2af27bf2443350bbec188ef6.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630206K21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4469
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630206K21"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        240..2162
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calpain 5 (MGD|MGI:1100859 GB|NM_007602, evidence:
FT                   BLASTN, 99%, match=4410)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U2P3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR033883"
FT                   /db_xref="InterPro:IPR033884"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="MGI:MGI:1100859"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2P3"
FT                   /protein_id="BAE33097.1"
FT                   /translation="MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTP
FT                   GPTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDW
FT                   KEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALV
FT                   EKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVH
FT                   SRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIR
FT                   LRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKC
FT                   RLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPED
FT                   EVLISIQQRPKRSTRREGKGENLAIGFNIYKVEENRQYRMHSLQHKAASSIYINSRSVF
FT                   LRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQ
FT                   VAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQP
FT                   ITVQVWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCSA
FT                   SLTAV"
FT   regulatory      4449..4454
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4469
FT                   /note="putative"
XX
SQ   Sequence 4469 BP; 967 A; 1292 C; 1207 G; 1003 T; 0 other;
     gtctggcctc caatgggagg aggctgagag gaggggcggg acagactgaa gcccgggggt        60
     ccaagttcca acccccgcct gcgggctgcc ggggtatcat ctccccgcag agtcccaggc       120
     tgtggcgcgg gctggtctag cctccgctcc agtgcccgca ctgtgctctg catcccggga       180
     gtccagctcc agctgcggcg acgcggcagg tgcctcccct tcttggggac gtggtcacca       240
     tgttctcctg cgcgaaggcc tatgaggacc agaactactc ggcgctgaag cgggcctgcc       300
     tgcgcaagaa ggtgctgttc gaggatcccc tcttccctgc caccgacgac tccctttact       360
     ataagggcac cccagggccc acagtcaggt ggaagcggcc taaggatatc tgcgacgatc       420
     cccggctctt cgtagatggc atcagctccc atgacctgca ccagggccag gtgggcaact       480
     gctggtttgt ggctgcctgc tcatcactgg cctcccgaga gtcactctgg cagaaggtca       540
     tcccagactg gaaggagcag gaatggaacc ccgagaagcc tgacagctat gctggcatct       600
     tccacttcaa cttctggcgc tttggggagt gggtggacgt aatcgtcgat gaccggctgc       660
     ccacagtcaa caaccagctc atttactgcc attccaactc caaaaatgag ttctggtgtg       720
     ccctggtgga gaaggcctat gccaagctgg ccggctgtta ccaggccctg gacggaggca       780
     acacggccga tgcattggtg gatttcacag gtggtgtttc tgaacccatt gacctgaccg       840
     agggggactt ggccactgac gaggctaaga ggaatcagct ctttgagcga gtgctgaagg       900
     tgcacagcag aggcgggctc atcagtgcct ccatcaaggc tgtgacagca gctgacatgg       960
     aggcccgcct ggcatgtggc ctggtgaagg gccatgcata cgctgtcacc gatgtgcgca      1020
     aggtgcgcct gggccatggc ctgctggcct tcttcaagtc agagaagctt gatatgatcc      1080
     gtctgaggaa cccctggggc gagcgggagt ggacggggcc ctggagtgac acgtcagagg      1140
     aatggcagaa agtgagcaag agtgagaggg agaagatggg cgtgaccgtg caggatgatg      1200
     gggaattctg gatgaccttt gaggacatgt gccggtactt tactgacatc attaaatgcc      1260
     gcctgattaa cacgtcctac ctgagcatcc ataagacatg ggaggaggcc cggctgcatg      1320
     gtgcctggac gagacatgag gacccacagc agaaccgcag tggaggctgc atcaaccaca      1380
     aggacacctt cttccagaac ccacagtacg tatttgaagt caagaagcca gaagatgaag      1440
     tgttgatcag tatccagcag cggccgaagc gctcaactcg ccgggagggc aaaggcgaga      1500
     atctggccat tggcttcaac atctataagg tggaagagaa ccgccaatac cgtatgcaca      1560
     gcctacagca taaggccgcc agctccatct acatcaattc ccgcagcgtt tttttgagga      1620
     cagagctgcc cgagggccgc tacgttatca tccctaccac ctttgagcca ggccacactg      1680
     gcgagttcct gctccgagtc ttcacagatg tcccctccaa ctgccgggaa ctacgcctgg      1740
     atgagccccc tcggacctgt tggagttccc tctgtggcta ccctcagcag gtggcccagg      1800
     tacatgtcct gggggctgct ggcctcaagg actccccaac aggagcaaac tcatatgtga      1860
     tcatcaagtg tgagggcgaa aaggttcgct cagctgtgca gagagggacc tcgacaccag      1920
     agtacaatgt aaaaggcatc ttctatcgca agaagctggc tcagcctatc accgtgcagg      1980
     tttggaatca ccgagtcctg aaggatgaat tcctgggcca ggtgcacctg aagactgccc      2040
     cggatgacct gcaggacctc cacaccctcc atctccagga ccgcagtagc cggcagccca      2100
     gtgacctgcc aggcattgta gctgtgcgag tcctctgcag tgcctctctc acggctgtct      2160
     gaccccagcc tgcctgtcct gccccactag tcctcaccac tactcgcatg tccccacctt      2220
     gcctgggacc agcctgggaa ccagacactg gggccctttc ctcactcttc cactgaccca      2280
     ctgtgtgacc tgaagagagc cctgccctct ctgagcctca gtgtttggag ggccccaaag      2340
     aattcccgtc ttgtggggga gttttcttgc ctaagattta atgcagttct ctctacccag      2400
     tgggcgctgc tgttaagggg ccatctgctg aaaacgtttc cccaggccct gctgtctgcc      2460
     aggagtgcca agtgtcaact gtttacacac aaactgccat gtcccacgcc ccttccctct      2520
     ccttgtttgc tatgggggag attgcttccc tccccagatc tttgctatgt agcttagagt      2580
     gaccttaaac ttatgatccc cctgcctcca cctcctcaat gccgtaccac tataccagtt      2640
     tgagtggtgc tgggtatgga acccagggct ttgtgcatgc taggcgagca cttaccaact      2700
     gagctacatc cccaatccca ctacagccca ttttaaaacc atcttgaaag aacccttatt      2760
     ggcatatgca ggagacatct gctcattgtc taatgcctga cccccattca tttagttatt      2820
     caatatagac ttgcccaatt agcccatcga gcctccctag gcttcccgat tctcaggtct      2880
     tctcggaggc agatcccttc ctgagctcca ggctctgact tcaccgtcac cctctgaaga      2940
     gctatgatca tgctggtgag aaagtatgat ttcccaacct ctgcttgtgg tgttggaagg      3000
     agtggcctgg ccaggcaggt tgatgtaagg ctatgggaga cccaggggga acacatgctg      3060
     cctctgctga aagaccctgg gtttttcttg gaagaaagga ctctagggtg gttggtacca      3120
     ggccttcagg gttagatcat ctgtcgagtg tcaccgatgg ggacttctca tgaccagagg      3180
     gctctgcacc agcatcccca aagagccaag aaggccacca tgcttttact gtccagacca      3240
     aaatgttgct ctcaatcccc aacatttgat agtcttagca tttaaacaaa atctccgagt      3300
     gagggaggcc agcccccaca tttgtcctct gcaggctcat tttgttgagc gtctgctttt      3360
     atcttgacac tgagcacgag agggcacggg tgggtgctca cagtgggacc ttcttggagg      3420
     aatctcagag ggggacagag atgagatgtg cattcctggc tgccacctgc attcctgagg      3480
     aactcttgtt tactggtgct gtggctcaca ggtccccctc tgtgccctcc ttcagcttcc      3540
     aggccagact tagtagataa atagtaataa taataataat acaattgagt tatcagccac      3600
     aattcctttt ggaactgtta cactctgcct ctggtccctc caacgtggtc ctcttcctgg      3660
     ctggaggtgc tggattctga ctgccatctt gctccatggt ggctcttctg gcctgggacc      3720
     cggtccacag gaagggctag gagctgaatt aaagatgaga gcatccctcc tgcacactgg      3780
     ggcttccctt caccaggagc aaatcacttc aacctcccgt gcctcgtttc ctccctctgt      3840
     agcatggggc tcgagactcc tgttggtgag ggactcttac aaggataaga gcaaggccac      3900
     accacttccg ctgtgtatca gtctatcata cactccgcac ggtcacatga tcacttcact      3960
     tctcgatggc tattgcagac caagactgca gtcaagaagg gagggtgagc ctcacgatct      4020
     tgggtctcag ggcctgacat aggggtctta gctcagccat atccctctga ggcacagggc      4080
     gagcagggac caagtagcag acgagtcgat gcttcacctg gcatctagcc actgcctccc      4140
     acttctagca gaactgggtc agcagccctg ttcttgcttc ctctctctta agctaggcca      4200
     ggctggctcc tggctgtgaa ggaacttccg gtccccaaga agccttgaag actggacaag      4260
     ggaggacagg gtggagcagg gatagccgtg gcttcattta tcgtttgcac ccaggaggcc      4320
     ttgtagtctt ccaattgcag gagatcagcc ctacagtgta ttctacgtga accaacaggg      4380
     cctggccttc actcctccag gccacaatgc cctggggtca agggaaagga actctgttat      4440
     cttctcagaa taaatattac tgccgctct                                        4469
//

If you have problems or comments...

PBIL Back to PBIL home page