(data stored in ACNUC1829 zone)

EMBL: AK155663

ID   AK155663; SV 1; linear; mRNA; HTC; MUS; 2543 BP.
XX
AC   AK155663;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F730112L14 product:CD37 antigen, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2543
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bfe9a84a2a761acdb6d4a46928a79041.
DR   Ensembl-Gn; ENSMUSG00000030798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031246; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031363; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000209779; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083753; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083767; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084290; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083880; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082420; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F730112L14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2543
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F730112L14"
FT                   /cell_type="B6-derived CD11 +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        89..847
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CD37 antigen (MGD|MGI:88330 GB|NM_007645, evidence:
FT                   BLASTN, 99%, match=772)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U1W9"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1W9"
FT                   /protein_id="BAE33374.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREVGLAVASSSGRVGLGLEPSGGRDF"
FT   regulatory      2519..2524
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2543
FT                   /note="putative"
XX
SQ   Sequence 2543 BP; 508 A; 710 C; 745 G; 580 T; 0 other;
     gtctttgccc actattcccc ttcccccctg cggccaacac ctcttctgtc tgggtttctc        60
     gagtgggtca ttccccatct aggcgaagat gtccgcccaa gagagttgcc tcagcctcat       120
     caagtacttc ctcttcgttt tcaacctctt cttctttgta ctaggcggcc tgattttctg       180
     cttcggcacc tggatcctca ttgacaagac cagcttcgtg tcctttgtgg gtttgtcctt       240
     cgtgccactg cagacttggt ccaaggtcct ggctgtctca ggtgtcctca ccatggccct       300
     ggctctcctg ggctgtgtgg gggctctaaa ggagctgcgc tgtctcctgg gcctgtattt       360
     tggaatgctg ctgctcctgt ttgccacaca gattaccctg ggcatcctca tttccactca       420
     gcgggtccgg ctggagcgaa gggtgcagga attggtgttg aggacgatcc agagctaccg       480
     cacgaatccg gatgagacag cagccgagga gagttgggac tatgcacagt tccagctgcg       540
     ctgctgcggc tggcaatctc cgcgggactg gaacaaggcc cagatgctga aagcgaacga       600
     gtctgaggag ccctttgtgc cctgctcctg ctacaactcc acggcgacca atgactccac       660
     cgtctttgat aagctctttt tctcccagct aagccggttg gggccgcggg cgaagctgag       720
     gcagactgct gacatatgtg cactccctgc aaaagctcac atctaccgtg aggtgggact       780
     agcggtagcc agtagctctg gacgtgtggg cctggggctg gagccgtctg gtgggaggga       840
     cttttaagag gtggaatctt aagagagtgg gcagggtttg gagggtgcgg ctataatcag       900
     aggcgtggct tcaggaccaa gggtagggaa aaaaacaaaa acaaaaccag aatctgggag       960
     atgagtgtgg ccacacaagc ttcaggagtc cagagcagaa agatgggcgg gggcggagag      1020
     agttcagggg acaactgatg tgttccagac ctacacgtgg cgtggcgtca gaaggcaggc      1080
     cttgggaggg taaggccagg ataaaagacc gagactgaaa gggcagtccc ttatatgtag      1140
     gcgtgaccta ctcaggggca tagtatgcca gcagatccta agctggactg ggctactaga      1200
     aaggtagtta tggaaggggc ggagtcctct gagggtgaga ggcatgatct aaataagggt      1260
     ggcacctgga acgctggccc agggcaaggc ttggataaga cctgggtgga tatctaggca      1320
     ttgggtacct aaaaagggat ccaagggttc ccttggctta agggtgagtt gcagaagcaa      1380
     cgcagccact acacgtcttc tgcatcccca gggctgcgcg cagagcctcc agaagtggct      1440
     gcacaacaat atcatctcca tagtgggaat ctgtctggga gtcggtcttc ttgaggtgac      1500
     ttgaccccgt ccccatgagt gatttgtcta ttgtagatgt ttccccattg ccgaggtaac      1560
     gcgcatactt agcggaggcg ttatttatca agcaatagca tggggtgggg cggaggcctg      1620
     gcttctctaa actctgaatg gctgtactcg cagtgctgcc tcctcccctc tcccgcaggt      1680
     gagcgggatg gcgctgtgtc tgcagctaca gcgccgagct ctcgctagag agcacgtgct      1740
     gccgctgtca ggagccgagg gttcgaaccc taccccaggg ctgaactctg aaggcagcag      1800
     cgggcgctgg ggcggtctaa gcagcggcag cggacgcagc agcaccccgt ggggcagctg      1860
     gggtatggcg ggtgcctgcc cgacatgggg ggccaaggct ccacaaggca agctacccat      1920
     ggcgctgggg ccctggtcct tgtgggatgc agaggaggag ccacttgaga ccgagagtgt      1980
     gggtgctgag gaggtcgagg cacagacgga ggctgttgcg gagcctccag aataaaggac      2040
     cctagctagg cttgccttga gctttctctt ttgcagactg ctgctgagct ttcgctctca      2100
     acgctgccaa tcacgcacag atgttatgta tgcccattct ttgcctctcc ctttgagtac      2160
     cacccttttc tccaaccctg aagtatctcc ttttttccca gctcggcttc atgacgctct      2220
     caatattcct gtgtagaaat ctggatcacg tctatgaccg gctggcccgg taccgctagg      2280
     ccccagccca cccatcggca cccacgcacc tccatgcagt caggaaatgt ttccttcctg      2340
     gttggtcaca ggcttggagc ccatgcctca ggcctcatcc cctggggacc cagctgtctg      2400
     ccctatcgac agccttcact ttccccacat ggccagggac ttttgtgccc agcttccttc      2460
     ccttcctggc tccctcctcc ccacaccatc tgtctgccac ctcccacatg acacctcaaa      2520
     taaatcccct ttgggttttt ggc                                              2543
//

If you have problems or comments...

PBIL Back to PBIL home page