(data stored in ACNUC1829 zone)

EMBL: AK155966

ID   AK155966; SV 1; linear; mRNA; HTC; MUS; 1186 BP.
XX
AC   AK155966;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830002H02 product:CD37 antigen, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1186
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 57c446f421754a5f604457af03763155.
DR   Ensembl-Gn; ENSMUSG00000030798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031246; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031363; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000098461; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083753; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083767; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084290; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083880; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082420; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830002H02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1186
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830002H02"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        77..922
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CD37 antigen (MGD|MGI:88330 GB|NM_007645, evidence:
FT                   BLASTN, 99%, match=1185)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q4FK35"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK35"
FT                   /protein_id="BAE33526.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
FT   regulatory      1162..1167
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1186
FT                   /note="putative"
XX
SQ   Sequence 1186 BP; 210 A; 380 C; 298 G; 298 T; 0 other;
     gattcccctt cccccctgcg gccaacacct cttctgtctg ggtttctcga gtgggtcatt        60
     ccccatctag gcgaagatgt ccgcccaaga gagttgcctc agcctcatca agtacttcct       120
     cttcgttttc aacctcttct tctttgtact aggcggcctg attttctgct tcggcacctg       180
     gatcctcatt gacaagacca gcttcgtgtc ctttgtgggt ttgtccttcg tgccactgca       240
     gacttggtcc aaggtcctgg ctgtctcagg tgtcctcacc atggccctgg ctctcctggg       300
     ctgtgtgggg gctctaaagg agctgcgctg tctcctgggc ctgtattttg gaatgctgct       360
     gctcctgttt gccacacaga ttaccctggg catcctcatt tccactcagc gggtccggct       420
     ggagcgaagg gtgcaggaat tggtgttgag gacgatccag agctaccgca cgaatccgga       480
     tgagacagca gccgaggaga gttgggacta tgcacagttc cagctgcgct gctgcggctg       540
     gcaatctccg cgggactgga acaaggccca gatgctgaaa gcgaacgagt ctgaggagcc       600
     ctttgtgccc tgctcctgct acaactccac ggcgaccaat gactccaccg tctttgataa       660
     gctctttttc tcccagctaa gccggttggg gccgcgggcg aagctgaggc agactgctga       720
     catatgtgca ctccctgcaa aagctcacat ctaccgtgag ggctgcgcgc agagcctcca       780
     gaagtggctg cacaacaata tcatctccat agtgggaatc tgtctgggag tcggtcttct       840
     tgagctcggc ttcatgacgc tctcaatatt cctgtgtaga aatctggatc acgtctatga       900
     ccggctggcc cggtaccgct aggccccagc ccacccatcg gcacccacgc acctccatgc       960
     agtcaggaaa tgtttccttc ctggttggtc acaggcttgg agcccatgcc tcaggcctca      1020
     tcccctgggg acccagctgt ctgccctatc gacagccttc actttcccca catggccagg      1080
     gacttttgtg cccagcttcc ttcccttcct ggctccctcc tccccacacc atctgtctgc      1140
     cacctcccac atgacacctc aaataaatcc cctttgggtt tttggc                     1186
//

If you have problems or comments...

PBIL Back to PBIL home page