(data stored in ACNUC6288 zone)

EMBL: AK158282

ID   AK158282; SV 1; linear; mRNA; HTC; MUS; 1632 BP.
XX
AC   AK158282;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult inner ear cDNA, RIKEN full-length enriched library,
DE   clone:F930050E24 product:eukaryotic translation initiation factor 2B,
DE   subunit 4 delta, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1632
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4b4008b1ec1745f2e3f78357829bc804.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029415; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028523; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029217; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028604; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070903; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070802; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071008; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069628; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Kirk W. Beisel ( Boys Town National
CC   Research Hospital 555 North 30th Street Omaha,NE 68131 USA ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F930050E24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1632
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F930050E24"
FT                   /tissue_type="inner ear"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        26..1600
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="eukaryotic translation initiation factor 2B, subunit
FT                   4 delta (MGD|MGI:95300 GB|NM_010122, evidence: BLASTN, 99%,
FT                   match=1631)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="BAE34444.1"
FT                   /translation="MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQ
FT                   QKKKRKEEKGADQEIGSAVSAAQRQDPIRELPGPGSQLGGTAGEKLPAGRSKAELRAER
FT                   RAKQEAERALKQARKGEQGGVPPQACPSTAGETTSGVKRVPEHTPADDPTLLRRLLRKP
FT                   DRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLISG
FT                   SNARCIALLHALQQVIQDYTTPPSEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFL
FT                   TKEVTGMSSSKREEEAKSELREALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGCS
FT                   SLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPEV
FT                   SKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNEL
FT                   DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVL
FT                   RVKSSDQ"
FT   regulatory      1615..1620
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1632
FT                   /note="putative"
XX
SQ   Sequence 1632 BP; 400 A; 436 C; 470 G; 326 T; 0 other;
     ggggaggagc ctaggaccca cagtcatggc tgcggtggcg gtggctgttc gcgaagaatc        60
     gagatccgag atgaagactg aactttctcc tcggcccggg gcagcagggc gggagttgac       120
     ccaagaagag aagcttcagc ttcgaaaaga aaagaaacag cagaagaaga aacggaagga       180
     ggaaaagggg gcagaccaag aaattggctc tgctgtgtct gcagctcaac ggcaagaccc       240
     aatcagagaa ctcccaggac ctggtagtca gctgggaggt actgctgggg agaaacttcc       300
     agctggccgg agtaaggcag aacttcgcgc cgaaaggaga gccaagcagg aggcagagcg       360
     ggccctgaaa caggcaagaa aaggggaaca aggaggcgtc cctcctcagg cctgccccag       420
     cactgctgga gaaaccacct caggagtgaa gcgtgtcccc gagcacaccc cagctgatga       480
     ccccacactt ctgaggaggc tccttagaaa gccagatcga caacaggttc ctacacgaaa       540
     ggattacgga tccaaagtca gtctcttctc ccacctgcct cagtacagca gacaaagctc       600
     cttgacccag tacatgagca tcccatcctc tgtgatccac ccagccatgg tgagactcgg       660
     tctgcagtac tcccagggcc tcatcagtgg ctccaatgcc cggtgcatcg cactgcttca       720
     cgccctgcag caggtgattc aggattacac aacacctccc agtgaggaac tctccaggga       780
     tcttgtaaat aaactaaaac cctacatcag cttcctgacg cagtgccgcc ccatgtcggc       840
     aagtatgtgc aacgccatca agttcctaac caaggaagtc actggcatga gcagctccaa       900
     gcgggaagag gaggccaagt cagaacttag agaagccctc gaccggtacg tgcaagagaa       960
     gatcgtgctt gcagctcagg caatttcacg atttgcttct acaaagatca gtgatgggga      1020
     cgtgatcctg gtatatggat gctcatcttt ggtgtcgaga attctccagg aggccagggt      1080
     cgagggcagg cggtttcggg tggtggtggt ggacagccgg ccccggctgg aaggaaggca      1140
     catgctccac tctcttgtcc gtgctggggt ccctacctcc tatctgctga ttcctgcagc      1200
     ctcctatgtg cttccagagg tttctaaggt gctattggga gctcatgcac tcctggccaa      1260
     tggatctgtg atgtctcggg tagggacagc acagttggcc ctggtggctc gagctcataa      1320
     cgttccagta ctggtctgct gtgaaacgta caagttctgt gaacgtgtgc agactgatgc      1380
     ctttgtctcc aacgagctag atgatcccga tgatctgcag tgtaagcggg gagaccaggt      1440
     ggccctggct aactggcaga gccacccgtc cctccggttg ttgaatctgg tctatgacgt      1500
     gactccacct gagctcgtgg atctggtgat cacagagttg ggcatgatcc cttgcagttc      1560
     tgtgcctgtt gttcttcgag tcaagagcag tgaccagtga agggaacaag ggtcaataaa      1620
     aagcttactc cc                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page