(data stored in ACNUC1829 zone)

EMBL: AK158729

ID   AK158729; SV 1; linear; mRNA; HTC; MUS; 3815 BP.
XX
AC   AK158729;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus visual cortex cDNA, RIKEN full-length enriched library,
DE   clone:K230306B11 product:Tetraspan NET-5 homolog (Hypothetical protein),
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3815
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9b70d2e75a976fc24e4cd3e1c651eeba.
DR   Ensembl-Gn; ENSMUSG00000030352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031318; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031289; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031296; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031020; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030401; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030981; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031137; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031086; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030486; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112173; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080321; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080400; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080322; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080337; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080804; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080536; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079912; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080069; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080107; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079966; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079053; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Michela Fagiolini and Takao K. Hensch (
CC   Laboratory for Neuronal Circuit Development Brain Science
CC   Institute RIKEN 2-1 Hirosawa,Wako-shi,Saitama 351-0198 Japan )
CC   whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=K230306B11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3815
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="K230306B11"
FT                   /tissue_type="visual cortex"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        68..787
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Tetraspan NET-5 homolog (Hypothetical protein)
FT                   (UniProt|Q8BJU2, evidence: FASTY, 100%ID, 100%length,
FT                   match=717)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BJU2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1924558"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJU2"
FT                   /protein_id="BAE34632.1"
FT                   /translation="MARGCLCCLKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWRTGCYEKVKLWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
FT   regulatory      3789..3794
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3815
FT                   /note="putative"
XX
SQ   Sequence 3815 BP; 786 A; 1074 C; 1035 G; 920 T; 0 other;
     ggtggtgcgg gagggagcgg agccggggcg ccacaccgag tccaagcgcg aatttaagaa        60
     gtgcaacatg gccaggggct gtctctgctg cttgaagtac acgatgttcc tcttcaattt       120
     gatattctgg ctctgtggct gtgggctgct tggagtgggc atctggctct ctgtgtccca       180
     aggcaacttc gccaccttct cccccagctt cccctcactg tccgcagcca acctcgtcat       240
     cgccatcggc accatcgtca tggtgacggg cttcctgggc tgcctggggg ccatcaagga       300
     gaacaagtgt ctgcttctca gcttcttcat cgtgctgttg atcatcctgc tggcagagtt       360
     gattctgatc atcctcttct tcgtctacat ggacaaggtg aacgagaatg ccaagcagga       420
     cctgaaagag gggctgctgc tctacaacac agagaacaac gtggggctca agaacgcctg       480
     gaacatcatc caggccgaga tgcggtgttg tggggtcact gactacacag actggtatcc       540
     ggtgctcggg gagaacacag ttcctgacag atgctgcatg gagaattccc agggctgtgg       600
     gcgcaacagc accaccccct tgtggagaac gggctgctac gaaaaagtga agctgtggtt       660
     tgatgacaac aagcacgtgc taggcaccgt gggcatgtgc atcctcatca tgcagatcct       720
     gggaatggcc ttttccatga cactgttcca gcacatccac cggacaggta aaaagtacga       780
     cgcctgaggc tgcggcagcg cctggctcca cccggacact gcgtgtgcca gggaagagga       840
     cccgagtcat gtctcctgcc tgctctccga tggccaccct gcaccacctg ccggcctgcc       900
     ctcccctgcc cacatccttg gccttagacc tcatggaggg cagaggccca gggatgaggc       960
     atcatgcaga gacctcaggg cttgggcaac tggattcctg tacctgcaga cttgccaaag      1020
     atgccggggc gggcagggtg tcagcgagga agccccttca acgatgggtg tctgcccctg      1080
     gccttcctca cactgacact tgttcctatg tggggtggag agtctgcccc atggaggcca      1140
     ctgccgtcca tggctgccca gccagagagc ctgccagggt gcagtgtggc accgccaggt      1200
     caggccccct ggagcaccct gcccgggttt ttatactata gtgtaacttt tttttttatt      1260
     ttactctgat tatgattatt caggaatatt atctctcaga taagtttagg gttagctctc      1320
     tgatttataa ctttttactg tgttgatttc cataatggtt tgagtttcct tttcctgtgg      1380
     gtggggatgg gtagagagag aggacctccg tccacgttca gtcaggacac accactgtgc      1440
     aacactcacg aggctggagg tagggtgaga agtgccagcc gtttttccag gactcacctt      1500
     gagggagagg gtgaggccat gatacggggc cctgccaggc ctggagacca tggatgaagg      1560
     ccagaagagg ctggtggcat acacagcatg ggccatgcta ctctggggtg agaggatgct      1620
     gcctgaacca gggagccaca tcagcagggc atgcttaggt caggggacag tgaaacgctt      1680
     tgccgggagg agtggcagtc agaacactgt ggcatttcct cttcctccct cggtcctccg      1740
     tgggctttga cccgcgagca tcctgcatcc cgaatggtca ctctcacaca ttcctgctgc      1800
     tgcaaattcc tctggttcag accccgctct cctcaccctg atccggagag tggaagcaga      1860
     catgttcctc tgcccagact gaaacagagt ctcaggacaa cccaggaagg gaggcagacc      1920
     ccaccagact cactcagttg cttactgccc tgctgagggg aaaggaaagg gccatgtggg      1980
     tctcaggacc attcctcctt aggatccatt gctgtccaca ctggggggca gacactgtag      2040
     cccatgtaac ctcaaagaca agatacagaa actctgagaa gtcaggcttc cactgccccc      2100
     acagcattgg ggagaagacc cttgttagat gcccagtgct aggccaagca gtcttgccaa      2160
     cactgatacc caacacatgt ccttccgtaa agacaggggc ctgtggaact gactgagcac      2220
     ctatctggga tccagatcct cactctctct cgggccttca cgtggtagct gcttttctcg      2280
     tgctatttgg ctctttacgc tgtttcccac caggccaggt gttctctggt ctagcaatga      2340
     catccaacca acctaaaacc cctctgacca ccttgaataa cagtgatgac caggatgtgg      2400
     aactttcagt acgttcagga ttcaagtttt gggggtgaga gaggatagcg gggagctctc      2460
     ggcagattgg tcccacaagt tgccagttcc aggagatgga attgtggtgt tattggagga      2520
     atgacagcta tcttccccca aggtgcagag ttcaggtaga aacaaacaga aagcaagcat      2580
     ggcgcctgct gcattatgag tgtggatggg tagggtgggt ttgtttatgc ctatctatgg      2640
     gtgtttaaac cttcattaac ttcaacattg aggtcccact accctagggg gcacttcgcc      2700
     tccctgcctc gtcacatctg tagagtgctt cagggtggtg ctggttcctg gagccttagc      2760
     tgaagtcctc cctcctcacc aacctcacct cacctgtctg ttcagcagag ccagatcata      2820
     agtcccaaac tgcctttttt gttttagctg tgtgtggttg catagtcatc tgcagagtct      2880
     tcacggcaca gaggtctcca tgcacagagt ggatgtcctg agaccctcac ttatcgtggg      2940
     gcaatggccc tcacatgcta gaagaccaca ccgagtaagg ctaggggaga tggctcagct      3000
     cttctctgac actcttgggt ctgagttcac tgaggtcctg ccatgaaatc tcccttacct      3060
     gcggcctccc ttgcctaagg cagagccgtt tccttcaggt accacacaag caatttgcag      3120
     acctgactca gaaagtcctc ttggtttgca ggtgacctca aggaaatgcc tggcgcagcc      3180
     tctggcattt ctccacagcc agctgcctca gtggggctca gagggtaggg tctggacagg      3240
     tgtctggtgc aggtctcctt gcgcctctgt actctgcgct ggcacattgt catcctgtct      3300
     ccgccagcct ggaccagcac ctcagctgtc ccccttgcac atgctctggc ctgacttaag      3360
     agttaagtgg tcaagccccc agctcacttc aggtggatgg aattggttgt cccctcctct      3420
     ctggacccct gcccaccctc tggtggaggt gctaactagc agggacatgg cacaggacag      3480
     ggagctgggt gccagatgct tggggtctgt tctttgcccc acggcccctg gcatcccttc      3540
     tcatgttccc gttctctcat ctccctcccc tcctccatga tggtggcatt ctggcctcac      3600
     cttcctgagt gggcattctg aggggagagg cctttgggcc tccacttgcc ttgctgtccc      3660
     ttggtggcca gagagccagg agtgcacgct attggtttcg aatgcacttt ctgcttgcaa      3720
     tgccttgtct gcatttcctt catcccaggt cccgctttaa cgaacaccat gtttttagca      3780
     tgtttttaaa taaaaactga tcatgtgtca aaagc                                 3815
//

If you have problems or comments...

PBIL Back to PBIL home page