(data stored in ACNUC7421 zone)

EMBL: AK160482

ID   AK160482; SV 1; linear; mRNA; HTC; MUS; 1009 BP.
XX
AC   AK160482;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult male stomach cDNA, RIKEN full-length enriched library,
DE   clone:2210013G01 product:PP6 homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1009
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0673a8bbba836e1f60a50b8e35322b60.
DR   Ensembl-Gn; ENSMUSG00000028601; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116309; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0066644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0065658; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2210013G01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1009
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2210013G01"
FT                   /tissue_type="stomach"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        111..686
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="PP6 homolog [Homo sapiens] (UniProt|Q8WY60,
FT                   evidence: FASTY, 91.1%ID, 100%length, match=405)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TLP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TLP5"
FT                   /protein_id="BAE35813.1"
FT                   /translation="MSDVEVGTFVQRLRGLMSEIAAFPVPTIAAMDGFALGGGLELALA
FT                   CDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELG
FT                   LVNHAVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMC
FT                   YAQNIPTQDRLEGMAAFREKRAPKFVGK"
FT   regulatory      989..994
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1009
FT                   /note="putative"
XX
SQ   Sequence 1009 BP; 233 A; 268 C; 277 G; 231 T; 0 other;
     atatctattc tttctgttct acctggcttc cttctgaccc tttatggagg aaatggagac        60
     actgagtccc aacatgctca caaggtgcag acctgaagga gcgggagcag atgagtgatg       120
     tggaggtggg gacctttgtc cagcggctcc gaggcctgat gagtgagatc gcagccttcc       180
     ctgtgcccac cattgcagcc atggatgggt ttgccttagg cgggggcttg gaacttgccc       240
     tggcctgtga cctccgaata gcagcttctt cggctgtcat ggggctaatt gagaccactc       300
     gaggacttct cccaggagca ggagggactc agaggctgcc tcgctgcctg ggcgtggccc       360
     tagcgaagga gctcatcttc acaggccggc gactgaacgg ggcacaggcc cgtgagttgg       420
     gcctggtaaa tcatgccgtg gctcagaatg aggagggtaa cgctgcctac caccgggccc       480
     tggcactggc acaggagatc ctgccccagg ctcccattgc tgtgcgcctg ggcaaagttg       540
     ccatcgacag aggaatggag gtggacattg catcagggat ggccatagaa cagatgtgct       600
     atgcccagaa catcccaacc caggacaggc tggaaggaat ggcagccttc agggagaaac       660
     gagctcccaa atttgtgggc aagtgaccca gctaacttta agcacacacc ataaagtcta       720
     gatcatccag agaaccaagg tactgaccat gcagtgcact gccaccttcc atactgctca       780
     ccttggctag tgactggact ctctgcattc aaaaacttcg ggtctttgtc attggctctg       840
     atcaccatgg atagagcaat gaggacttac ttactctcac agagtttctt tgagttagtg       900
     tcaggagccc tccagctctc tgtaacgcaa ggggaattct ggacaaacta tttaacctct       960
     ctatcagtct ctctgatatc cctgtgttaa taaacatgct gcaactgtt                  1009
//

If you have problems or comments...

PBIL Back to PBIL home page