(data stored in ACNUC7421 zone)

EMBL: AK163250

ID   AK163250; SV 1; linear; mRNA; HTC; MUS; 2954 BP.
XX
AC   AK163250;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 2 cells egg cDNA, RIKEN full-length enriched library,
DE   clone:B020006B14 product:DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3,
DE   X-linked, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2954
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6b170f56fe31f652b6493612d17f40ae.
DR   Ensembl-Gn; ENSMUSG00000000787; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035571; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035549; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035542; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035380; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035327; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035462; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036083; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034686; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000804; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095689; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095693; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096214; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095870; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095387; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095408; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096545; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094252; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B020006B14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2954
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 cells"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B020006B14"
FT                   /tissue_type="egg"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        67..2055
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3,
FT                   X-linked (MGD|MGI:103064 GB|NM_010028, evidence: BLASTN,
FT                   99%, match=2951)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TQX5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQX5"
FT                   /protein_id="BAE37257.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRN
FT                   REATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDY
FT                   DGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKY
FT                   DDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
FT                   CAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQ
FT                   IYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDF
FT                   CKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDE
FT                   YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLE
FT                   DFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFD
FT                   LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAF
FT                   EHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFG
FT                   GGGYGGFYNSDGYGGNYNSQGVDWWGN"
XX
SQ   Sequence 2954 BP; 867 A; 548 C; 745 G; 794 T; 0 other;
     gcttttgcgg tagaggcagc ctttgctcag cagcggaaga ctccgatttc tcggtactct        60
     tcagggatga gtcatgtggc agtggaaaat gcgctcgggc tggaccagca gtttgctggc       120
     ctagacctga actcttcaga taatcagagt ggaggaagta cagcaagcaa agggcgttat       180
     atcccacctc atttaaggaa cagagaagct actaaaggat tctatgacaa agacagttca       240
     gggtggagtt ctagtaaaga taaggatgca tacagcagtt ttggatcacg gggtgattca       300
     agagggaagt ctagcttctt tggagatcgt ggaagtggat caaggggaag gtttgatgat       360
     cgtggacggg gagactatga tggcattggt ggccgtggag atagaagtgg ctttggcaaa       420
     tttgaaagag gtggaaatag tcgctggtgt gacaaatcag atgaagatga ctggtcaaag       480
     ccactcccac caagtgaacg attggaacag gaactctttt ctggaggcaa tactgggatt       540
     aactttgaga aatatgatga cattccagtc gaagcaacag gcaacaactg tcctccacac       600
     attgaaagtt tcagtgatgt cgagatggga gaaattatta tgggaaacat tgagcttact       660
     cgttatactc gcccaactcc agtgcagaag catgctattc ctattatcaa agagaaaaga       720
     gacttgatgg cttgtgctca aacaggctct ggaaaaactg cagcatttct cttgcccatc       780
     ttgagtcaga tctatgctga tggtccagga gaagctctga gggctatgaa ggaaaatgga       840
     agatatggcc gtcgtaaaca gtatccaatc tctttggtac tggcaccaac gagagaattg       900
     gcagtgcaga tctatgagga agccagaaaa ttctcatacc gatctagagt ccgtccttgc       960
     gtggtttatg gtggtgctga aattggccag cagattcgag acttagaacg tggatgccac      1020
     ttgttagtag ccactccagg acgtctagtg gatatgatgg agagagggaa gatcgggtta      1080
     gacttctgca aatacctggt gttagatgaa gctgaccgga tgttagatat ggggtttgaa      1140
     cctcagatac gaagaatagt tgaacaagac actatgcctc caaaaggtgt ccgccacact      1200
     atgatgttta gtgctacttt tcctaaggaa atacagatgc tggcccgtga tttcttagat      1260
     gagtacatat ttctggctgt aggaagagtt gggtctactt cagagaacat cacacaaaaa      1320
     gtggtttggg tggaggagat agacaaaagg tcatttctgc ttgaccttct aaatgcaaca      1380
     ggcaaggatt ccctgactct agtgtttgtg gagaccaaaa agggggcaga ttcgctggag      1440
     gatttcttat accatgaagg atatgcttgt accagtatcc atggagaccg ttctcagaga      1500
     gatagggaag aggcccttca ccagttccgc tcaggaaaaa gcccaattct agtggctaca      1560
     gcagtagcag caagaggact ggatatttca aatgtgaagc atgttattaa ttttgacctg      1620
     cctagtgata tcgaagaata tgtgcatcgc ataggccgta caggccgtgt gggaaacctt      1680
     ggtcttgcca cctcattctt taatgaaagg aatataaata tcacaaagga tttactggat      1740
     cttcttgttg aagcaaaaca agaagtgcct tcttggttag agaacatggc ttttgaacac      1800
     cactacaagg gtagcagtcg tggacgttct aagagcagtc gatttagtgg agggtttggt      1860
     gccagagact accgacagag tagcggtgcc agcagttcca gcttcagcag cagccgtgca      1920
     agcagcagtc gaagtggtgg aggtggccat ggcggcagtc gaggatttgg tggaggtggc      1980
     tacggaggct tttacaacag tgatggatat ggagggaatt ataactccca gggggttgac      2040
     tggtggggta actgagcctg ctctgtagta ggtcaccctg ccaaacaagc taatatggaa      2100
     accacatgta acttagccag actatacctt gtgtagcttc aagaactcgc agtacattac      2160
     cagctgtgat tctccactga aatttttttt ttaagggagc tcaaggtcac aagtaaagat      2220
     gaaaggaaca atcagcagcc ctgtctgaag gtggtttgaa gacttcattg ctgtagtttg      2280
     gattaacgcc cctcccgcct acccctatcc caaactgcat ttataatttt gtgactgagg      2340
     atcatttgtt tgttaatgta ctgtgccttt aactttagac aactttttat tttgatgtcc      2400
     tgttggctca gtaatgctca agattccaat tgtttttgac aaaataaatt tactgaactt      2460
     gggctaaaat caaaccttgg cacacaggtg tgatacaact taacaggaat catcgattca      2520
     tccataaata atataaggaa aaactcaagt ggtagcctgt cttaaggctt ttgatacttg      2580
     cagattgggg aaaaacaaac aacaaacgtc ttgaagcata ttaatggaat tagtttctaa      2640
     tgtggcaaac tgtattaagt taaaagttct gatttgctca ctctatcctg gataggtatt      2700
     tagaacctga taatagtctt taaacaagcc attccagtca tgatgaggtg atgtatggat      2760
     acatgcatac attcaaagca ctgttctcaa agttaatgca agtaaataca gcaattcctc      2820
     tttcaatgtt taggcagatc gttaactatg agctagccaa atgtgggcat gttattacag      2880
     ggaaagttta aaggtctgat aacttgaaat aggtttagga gaattcatct acttagactt      2940
     tttaaatgcc tgcc                                                        2954
//

If you have problems or comments...

PBIL Back to PBIL home page