(data stored in ACNUC31108 zone)

EMBL: AK163395

ID   AK163395; SV 1; linear; mRNA; HTC; MUS; 2591 BP.
XX
AC   AK163395;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 2 cells egg cDNA, RIKEN full-length enriched library,
DE   clone:B020032E19 product:Tetraspan NET-5 homolog (Hypothetical protein),
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2591
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1e6c1b1eb244506cf22c3ceaee9221f6.
DR   Ensembl-Gn; ENSMUSG00000030352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031318; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031289; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031296; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031020; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030401; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030981; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031137; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031086; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030486; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112173; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080321; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080400; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080322; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080337; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080804; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080536; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079912; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080069; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080107; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079966; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079053; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B020032E19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2591
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 cells"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B020032E19"
FT                   /tissue_type="egg"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        239..958
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Tetraspan NET-5 homolog (Hypothetical protein)
FT                   (UniProt|Q8BJU2, evidence: FASTY, 100%ID, 100%length,
FT                   match=717)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BJU2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1924558"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJU2"
FT                   /protein_id="BAE37332.1"
FT                   /translation="MARGCLCCLKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWRTGCYEKVKLWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
XX
SQ   Sequence 2591 BP; 564 A; 723 C; 716 G; 588 T; 0 other;
     ggccattgct gcccagaatt ggccctggtg tggctccaca gtgaagcaat gatttaagtt        60
     tgcattttcg tgtgggagca tcccagagcc aagctgcttg caagaaattc aaggaaacca       120
     gcgttgcagc tggcgaagac ttgggaagtc agatccaagc tgtcccctct cagaggagag       180
     tgagaggatc cagctcaggt gacccaggca ggcagtcaga gaatttaaga agtgcaacat       240
     ggccaggggc tgtctctgct gcttgaagta cacgatgttc ctcttcaatt tgatattctg       300
     gctctgtggc tgtgggctgc ttggagtggg catctggctc tctgtgtccc aaggcaactt       360
     cgccaccttc tcccccagct tcccctcact gtccgcagcc aacctcgtca tcgccatcgg       420
     caccatcgtc atggtgacgg gcttcctggg ctgcctgggg gccatcaagg agaacaagtg       480
     tctgcttctc agcttcttca tcgtgctgtt gatcatcctg ctggcagagt tgattctgat       540
     catcctcttc ttcgtctaca tggacaaggt gaacgagaat gccaagcagg acctgaaaga       600
     ggggctgctg ctctacaaca cagagaacaa cgtggggctc aagaacgcct ggaacatcat       660
     ccaggccgag atgcggtgtt gtggggtcac tgactacaca gactggtatc cggtgctcgg       720
     ggagaacaca gttcctgaca gatgctgcat ggagaattcc cagggctgtg ggcgcaacag       780
     caccaccccc ttgtggagaa cgggctgcta cgaaaaagtg aagctgtggt ttgatgacaa       840
     caagcacgtg ctaggcaccg tgggcatgtg catcctcatc atgcagatcc tgggaatggc       900
     cttttccatg acactgttcc agcacatcca ccggacaggt aaaaagtacg acgcctgagg       960
     ctgcggcagc gcctggctcc acccggacac tgcgtgtgcc agggaagagg acccgagtca      1020
     tgtctcctgc ctgctctccg atggccaccc tgcaccacct gccggcctgc cctcccctgc      1080
     ccacatcctt ggccttagac ctcatggagg gcagaggccc agggatgagg catcatgcag      1140
     agacctcagg gcttgggcaa ctggattcct gcacctgcag acttgccaaa gatgccgggg      1200
     cgggcagggt gtcagcgagg aagccccttc aacgatgggt gtctgcccct ggccttcctc      1260
     acactgacac ttgttcctat gtggggtgga gagtctgccc catggaggcc actgccgtcc      1320
     atggctgccc agccagagag cctgccaggg tgcagtgtgg caccgccagg tcaggccccc      1380
     tggagcaccc tgcccgggtt tttatactat agtgtaactt ttttttttta ttttactctg      1440
     attatgatta ttcaggaata ttatctctca gataagttta gggttagctc tctgatttat      1500
     aactttttac tgtgttgatt tccataatgg tttgagtttc cttttcctgt gggtggggat      1560
     gggtagagag agaggacctc cgtccacgtt cagtcaggac acaccactgt gcaacactca      1620
     cgaggctgga ggtagggtga gaagtgccag ccgtttttcc aggactcacc ttgagggaga      1680
     gggtgaggcc atgatacggg gccctgccag gcctggagac catggatgaa ggccagaaga      1740
     ggctggtggc atacacagca tgggccatgc tactctgggg tgagaggatg ctgcctgaac      1800
     cagggagcca catcagcagg gcatgcttag gtcaggggac agtgaaacgc tttgccggga      1860
     ggagtggcag tcagaacact gtggcatttc ctcttcctcc ctcggtcctc cgtgggcttt      1920
     gacccgcgag catcctgcat cccgaatggt cactctcaca cattcctgct gctgcaaatt      1980
     cctctgggtt cagagccccg ctctgcctca ccctgatccg gagagtggaa gcagacatgt      2040
     tcctctgccc agactgaaac agagtctcag gacaacccag gaagggaggc agaccccacc      2100
     agactcactc agttgcttac tgccctgctg aggggaaagg aaagggccat gtgggtctca      2160
     ggaccattcc tccttaggat ccattgctgt ccacactggg gggcagacac tgtagcccat      2220
     gtaacctcaa agacaagata cagaaactct gagaagtcag gcttccactg cccccacagc      2280
     attggggaga agacccttgt tagatgccca gtgctagggc caagcagtct tgccaacact      2340
     gatacccaac acatgtcctt ccgtaaagac aggggcctgt ggaactgact gagcacctat      2400
     ctgggatcca gatcctcact ctctctcggg ccttcacgtg gtagctgctt ttctcgtgct      2460
     atttggctct ttacgctgtt tcccaccagg ccaggtgttc tctggtctag caatgacatc      2520
     caaccaacct aaaacccctc tgaccacctt gaataacagt gatgaccagg atgtggaact      2580
     ttcagtacgc t                                                           2591
//

If you have problems or comments...

PBIL Back to PBIL home page