(data stored in ACNUC8465 zone)

EMBL: AK166137

ID   AK166137; SV 1; linear; mRNA; HTC; MUS; 1428 BP.
XX
AC   AK166137;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus lung RCB-0558 LLC cDNA, RIKEN full-length enriched library,
DE   clone:G730044F23 product:mitogen activated protein kinase kinase 5, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1428
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5f9c538cebdd7ee90cd1073c77e426a3.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G730044F23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1428
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G730044F23"
FT                   /cell_line="RCB-0558 LLC"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        647..>1428
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 5
FT                   (MGD|MGI:1346345 GB|NM_011840, evidence: BLASTN, 99%,
FT                   match=1332)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TM51"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR034851"
FT                   /db_xref="MGI:MGI:1346345"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TM51"
FT                   /protein_id="BAE38591.1"
FT                   /translation="MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL
FT                   DVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQI
FT                   FPRACKPPGERNIHGLKVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNE
FT                   QDIRYRDTLGHGNGGTVYKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSS
FT                   YIIGFYGAFFVENRISICTEFMDGELFPLNYIKNDFLNR"
XX
SQ   Sequence 1428 BP; 312 A; 417 C; 358 G; 341 T; 0 other;
     gggttccgga gtaacagcgg tctaacggcc gccttcctcc tcctctcgcc gccacctccg        60
     ctgccgggac gcgggcctca gtcggacgat cctgcacgcg ccgcgccctc cggttccggc       120
     tgcggtccgg gacccgcccc ttgaccccgc ggccctgggc ccccctgcct ggttggaggg       180
     caggcgccac cggtgcacct cagaaacagc cccgacccag cccgcggcgc ccggccaccg       240
     tccccttgcc caccgagaca ctcaggacgg caggaccctg gccactgtac ctgccttaaa       300
     ccaggccgtt gctccgctgt ctcctcttac tcacaaggac tacagaatgc ttgtgggttc       360
     tgttttgtcc acttttgtaa ctccaggacc ttccgctctc tactaattcc tcttggccgg       420
     tcccccaaca gtgcatcctc tcctagggac actccacacg acctgggcct ggttttgggc       480
     ctgcaagctc cctcctgatc gctcctcttc acttctcccc atcttcttgc tccctattta       540
     tcgcctgcct tctgtctatc gttccccttg tcacttcttg gggctcctcc taagtagggg       600
     caggtcggta cccctcgccc caggatgtga gaccctttaa cctgtaatgc tgtggctggc       660
     ccttggcccc ttctgtgcca tggagaacca ggtgctggtg attcggatca agattccaaa       720
     tagtggcgcg gtggactgga ccgtgcactc cgggccgcag ttactcttca gggatgttct       780
     ggatgtgata ggccaggttc tgcctgaagc gacgacgaca gcgtttgaat atgaagatga       840
     agatggtgat aggattacag taagaagcga tgaagagatg aaggcaatgc tgtcctacta       900
     ttattccaca gtaatggaac agcaagtaaa tggccagcta atagagccgc tgcagatatt       960
     tccaagagcc tgcaagcctc ctggggaacg gaacatacat ggcctgaagg tgaatacacg      1020
     ggctgggcca tctcaacaca ccagccctgt ggtctcagat tcgcttccaa gcaatagctt      1080
     gaagaagtcc tcagctgaac tgagaaagat actggccaac ggccagatga atgaacaaga      1140
     catacggtat cgagacaccc ttggtcatgg caacggaggc acagtctaca aagcacatca      1200
     tgtcccaagt gggaaaattt tagctgtaaa ggttattctg ttagacatta cactggagct      1260
     tcagaagcag atcatgtctg agctggaaat cctttataag tgtgactcat cgtatatcat      1320
     aggattttac ggggcatttt tcgtagaaaa caggatttca atttgtacag aattcatgga      1380
     tggtgagttg ttccctttaa actacattaa aaatgatttt ttgaatcg                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page