(data stored in ACNUC7421 zone)

EMBL: AK166388

ID   AK166388; SV 1; linear; mRNA; HTC; MUS; 1232 BP.
XX
AC   AK166388;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus mammary gland RCB-0527 Jyg-MC(B) cDNA, RIKEN full-length
DE   enriched library, clone:G930007D01 product:PP6 homolog [Homo sapiens], full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1232
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1d10c82afe146f4682dab0d7a372616e.
DR   Ensembl-Gn; ENSMUSG00000028601; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116309; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0066644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0065658; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G930007D01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1232
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G930007D01"
FT                   /cell_line="RCB-0527 Jyg-MC(B)"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        65..955
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="PP6 homolog [Homo sapiens] (UniProt|Q8WY60,
FT                   evidence: FASTY, 91.1%ID, 100%length, match=405)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TLP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TLP5"
FT                   /protein_id="BAE38747.1"
FT                   /translation="MLRVLPRALRLPCPWRFSGARDCASHATTRTPEIQVQALTGPNQG
FT                   ITEIVMNRPHARNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFCAGADLKERE
FT                   QMSDVEVGTFVQRLRGLMSEIAAFPAPTIAAMDGFALGGGLELALACDLRIAASSAVMG
FT                   LIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEEGN
FT                   AAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEG
FT                   MAAFREKRAPKFVGK"
FT   regulatory      1212..1217
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1232
FT                   /note="putative"
XX
SQ   Sequence 1232 BP; 264 A; 356 C; 356 G; 256 T; 0 other;
     gacgattttc cagctctgcc gaggaggtcc cgttctccgc gccaccttgc cggcctgctc        60
     cccgatgcta cgcgtactgc cccgcgcgct gcgcctcccg tgcccctgga ggttctcggg       120
     ggcccgggac tgcgcctctc acgcgacgac caggacaccc gaaatccaag tgcaggctct       180
     gacaggtccc aaccaaggaa tcactgagat tgtgatgaac agacctcatg cccgcaatgc       240
     cttggggaat gtgtttgtta gtgagctgct ggaagctctg gcccagcttc gggaagacca       300
     gcaagtccgg gtcctgctct tcagaagtgc ggtgaaggga gtgttctgtg caggtgcaga       360
     cctgaaggag cgggagcaga tgagtgatgt ggaggtgggg acctttgtcc agcggctccg       420
     aggcctgatg agtgagatcg cagccttccc tgcgcccacc attgcagcca tggacgggtt       480
     tgccttaggc gggggcttgg aacttgccct ggcctgtgac ctccgaatag cagcttcttc       540
     ggctgtcatg gggctaattg agaccactcg aggacttctc ccaggagcag gagggactca       600
     gaggctgcct cgctgcctgg gcgtagccct agcgaaggag ctcatcttca caggccggcg       660
     actgaacggg gcacaggccc gtgagttggg cctggtaaat catgccgtgg ctcagaatga       720
     ggagggtaac gctgcctacc accgggccct ggcactggca caggagatcc tgccccaggc       780
     tcccattgct gtgcgcctgg gcaaagttgc catcgaccga ggaatggagg tggacattgc       840
     atcagggatg gccatagaac agatgtgcta tgcccagaac atcccaaccc aggacaggct       900
     ggaaggaatg gcagccttca gggagaaacg agctcccaaa tttgtgggca agtgacccag       960
     ctaactttaa gcacacacca taaagtctag atcatccaga gaaccaagtg cactgccacc      1020
     ttccatactg ctcaccttgg ctagtgactg gactctctgc attcaaaaac ttcgggtctg      1080
     cgtcattggc tctgatcacc atggatggag caatgccctc agactccagc tctctgtaat      1140
     gcaagggtaa ttctggacaa accatttaac ctctctatca gtctctctga cgacttaata      1200
     tccctgtgtt caataaacat gctgcaactg tt                                    1232
//

If you have problems or comments...

PBIL Back to PBIL home page