(data stored in ACNUC7421 zone)

EMBL: AK166965

ID   AK166965; SV 1; linear; mRNA; HTC; MUS; 1246 BP.
XX
AC   AK166965;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus blastocyst blastocyst cDNA, RIKEN full-length enriched
DE   library, clone:I1C0025L16 product:PP6 homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1246
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5188f84d810c9cba574f176ec3d1d9ca.
DR   Ensembl-Gn; ENSMUSG00000028601; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116309; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0066644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0065658; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I1C0025L16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1246
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="blastocyst"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I1C0025L16"
FT                   /cell_type="blastocyst"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        35..925
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="PP6 homolog [Homo sapiens] (UniProt|Q8WY60,
FT                   evidence: FASTY, 91.1%ID, 100%length, match=405)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TLP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TLP5"
FT                   /protein_id="BAE39148.1"
FT                   /translation="MLRVLPRALRLPCSWRFSGARDCASHATTRTPEIQVQALTGPNQG
FT                   ITEILMNRPNARNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFCAGADLKERE
FT                   QMSDVEVGTFVQRLRGLMSEIAAFPVPTIAAMDGFALGGGLELALACDLRIAASSAVMG
FT                   LIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEEGN
FT                   AAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEG
FT                   MAAFREKRAPKFVGK"
FT   regulatory      1228..1233
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1246
FT                   /note="putative"
XX
SQ   Sequence 1246 BP; 271 A; 348 C; 360 G; 267 T; 0 other;
     ggttctccgc gccaccttgc cggcctgctc cccgatgcta cgcgtactgc cccgcgcgct        60
     gcgcctcccg tgctcctgga ggttctcggg ggcccgggac tgcgcctctc acgcgacgac       120
     caggacaccc gaaatccaag tgcaggctct gacaggtccc aaccaaggaa tcactgagat       180
     tctgatgaac agacctaatg cccgcaatgc cttggggaat gtgtttgtta gtgagctgct       240
     ggaagctctg gcccagcttc gggaagacca gcaagtccgg gtcctgctct tcagaagtgc       300
     ggtgaaggga gtgttctgtg caggtgcaga cctgaaggag cgggagcaga tgagtgatgt       360
     ggaggtgggg acctttgtcc agcggctccg aggcctgatg agtgagatcg cagccttccc       420
     tgtgcccacc attgcagcca tggatgggtt tgccttaggc gggggcttgg aacttgccct       480
     ggcctgtgac ctccgaatag cagcttcttc ggctgtcatg gggctaattg agaccactcg       540
     aggacttctc ccaggagcag gagggactca gaggctgcct cgctgcctgg gcgtggccct       600
     agcgaaggag ctcatcttca caggccggcg actgaacggg gcacaggccc gtgagttggg       660
     cctggtaaat catgccgtgg ctcagaatga ggagggtaac gctgcctacc accgggccct       720
     ggcactggca caggagatcc tgccccaggc tcccattgct gtgcgcctgg gcaaagttgc       780
     catcgacaga ggaatggagg tggacattgc atcagggatg gccatagaac agatgtgcta       840
     tgcccagaac atcccaaccc aggacaggct ggaaggaatg gcagccttca gggagaaacg       900
     agctcccaaa tttgtgggca agtgacccag ctaactttaa gcacacacca taaagtctag       960
     atcatccaga gaaccaaggt actgaccatg cagtgcactg ccaccttcca tactgctcac      1020
     cttggctagt gactggactc tctgcattca aaaacttcgg gtctttgtca ttggctctga      1080
     tcaccatgga tagagcaatg aggacttact tactctcaca gagtttcttt gagttagtgt      1140
     caggagccct ccagctctct gtaacgcaag gggaattctg gacaaactat ttaacctctc      1200
     tatcagtctc tctgatatcc ctgtgttaat aaacatgctg caactg                     1246
//

If you have problems or comments...

PBIL Back to PBIL home page