(data stored in ACNUC13479 zone)

EMBL: AK167039

ID   AK167039; SV 1; linear; mRNA; HTC; MUS; 2997 BP.
XX
AC   AK167039;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus blastocyst blastocyst cDNA, RIKEN full-length enriched
DE   library, clone:I1C0028K06 product:signal recognition particle receptor, B
DE   subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2997
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c3eba2996175fd4b48a652bad3c01f0b.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I1C0028K06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2997
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="blastocyst"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I1C0028K06"
FT                   /cell_type="blastocyst"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        13..822
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal recognition particle receptor, B subunit
FT                   (MGD|MGI:102964 GB|AK030437, evidence: BLASTN, 99%,
FT                   match=2991)"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="BAE39207.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
FT   regulatory      2983..2988
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2997
FT                   /note="putative"
XX
SQ   Sequence 2997 BP; 711 A; 771 C; 782 G; 733 T; 0 other;
     gacacctctt tcatggcttc ggcgaacacc cggcgagttg gcgatggcgc cggtggcgcc        60
     ttccagcctt acctcgactc cttacgacag gagctgcagc agagggatcc gacgctgctc       120
     tccgtggcgg tggctctcct ggcggtgctg ctgacgctgg tgttctggaa gttcatctgg       180
     agccgaaaga gcagtcagag agctgttctc ttcgttggtc tctgtgactc tgggaaaacg       240
     ttgctgtttg tcaggttgct aactggccag tacagagaca cacagacttc cattaccgat       300
     agttctgcca tatacaaagt caacaataac aggggtaaca gcctgactct gatcgacctc       360
     cccgggcatg agagcttgag gtttcagctc ttagatcgct ttaagtcttc agctagggct       420
     gtggtgtttg tggtggacag tgcggcgttc cagcgggagg tgaaagatgt ggccgaattt       480
     ctgtaccagg tcctcatcga cagcatggct ctgaagaact caccgtcctt attaatagcc       540
     tgcaataagc aagatatcgc aatggcaaaa tcagcgaagt tgatccagca gcagcttgag       600
     aaggagctca acaccttacg agtcacccgg tccgcggctc ccagcacact ggacagttcc       660
     agcaccgcac ctgctcagtt ggggaagaaa ggcaaagaat ttgaattttc ccagttgcca       720
     ctcaaagtgg agttcctgga gtgtagtgcc aagggtggac gaggggacac tggctctgct       780
     gacatccagg acttggagaa gtggctggcc aagattgcct gaggagcatc gctggccaca       840
     agcgttggtc atgtgagact gaccctgcag tttgagaaag ggcggtggtg gtgtggactg       900
     ataaagaggg ggcatgtcgt tgaagcattt cttgagttct tgaaacaatt gtaccacccc       960
     caccccaccc ccgtcagctc ctttctcagc tagtcctttc ttaattccca tattctttct      1020
     ccctttgcta ggtgttaggt gtagcatcat gttagtgtga gacataacag agagggcatc      1080
     gctttgagag tagggtcgca tctgagaagt ccttgtctcc tgcctctgtg ttggtccctt      1140
     ttcctgggac cagatctgcc tgcttgtgga ataagtgaac ttgcagttgc ccctggtgta      1200
     ggcataatac agtgtcagtt cttagtggag tctggggtgt gaaggtctac agtgaagaca      1260
     gcttcaaagc cacaggcaca gctgacagtg tgtccttcac gggctcagtg accatcccac      1320
     accaccctag ctgacagtgt gtccttcacg ggctcggtga ccatcccaca ccaccctagc      1380
     tgacagtgtg tccttcacgg gctcggtgac catcccacac caccctagct gacagtgtgt      1440
     ccttcacagg ctcggtgacc atcccacacc accctagctg acagtgtgtc cttcatgggc      1500
     tcggtgacca tcccacacca ccctagctga cagtgtgtcc ttcacgggct cggtgaccat      1560
     ccccacacca ccctaggttc aaaagctgcc gcaaccccga agagtcaccc tcacaaggtg      1620
     gctctaggag ccaaatcccc agacactcct aggttagtgt tctagaggct ccactgggga      1680
     gagcagggag acagcacact gctgcctcgg gcgtgcgtga gcccaggctg tcccctgtgc      1740
     tacttgatca gctcctgttg tgtcacccca gctagagtgc tatggaacaa tacaaactga      1800
     agatgtccac tgtgcatttt aaatacatat ttattcatga tgctttaaaa aatgttacct      1860
     ttttaaagtg atgctgtctt caacatttgt gttctcattg cttttataaa tgactggtat      1920
     cttgataaat gactatactg aaagcattga gtcaaatgat gagtacaagt gggaacctga      1980
     gctagaattg aaccccagct ccaggttact gagcctacag atcgctgcat atatgagact      2040
     cttggtctcg tctcacactc agagtcaggc ttcactaaag ccacactaaa gagacaggca      2100
     gagcattgac tcaggtgcag tgctcaggga atatgtgtgg cgctctgggc tggcctggac      2160
     cagtgagagg gacaggataa acacacaggt gttctctgtg cagaccagcc caagcctctg      2220
     cctgctgaca catggcctcc ctgtgggtca cctgggctga taatagagtc ccagaccatg      2280
     attcccatca agtactcagc tccccactcc taaaatatct actggccttg cttatggtgt      2340
     atgagacaga tacagcacag cacaggacag ataagccatg agatgactca gttctcactg      2400
     ggaggcagta ttgctgctag gattcttact gccctttgca cactgctgtt catgttggtc      2460
     acggacaaat gggaagggca cgatgaagga cgttcacatc acagtaggtg ctcatcaaaa      2520
     aaaacctttc agttagaaaa tgtgttcgct ggcctccctt ttgtctgcat aataaagtga      2580
     ttttacttag tgggagaatc agtacatcaa aaaagtgaca aggatggaga gcaaggataa      2640
     atgttattta tttatttata gcctgtgtcc tgagcaaaag gtaagctgtg cagggctggg      2700
     aaccaggtta gtagaatgcc tacctggaac gcatgggtct ggctttgctg tgggctgctg      2760
     taaaagccag ctctaaacag gcagccgcag caaagattct atgtctggac tcttccatgg      2820
     agccacggca gaagcagctt ctcactgcta ggtgccttgt ggtctctcgg gaggccttgg      2880
     cccctgccac tgcttcccag ggcctccagc acctcctgac gtgagctgtt ctatcagagg      2940
     ggaggggagg cagtggccca gccattgagc tatttcaggc acaataaaat ataaggc         2997
//

If you have problems or comments...

PBIL Back to PBIL home page