(data stored in ACNUC9543 zone)

EMBL: AK167792

ID   AK167792; SV 1; linear; mRNA; HTC; MUS; 514 BP.
XX
AC   AK167792;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 9)
XX
DE   Mus musculus CRL-1722 L5178Y-R cDNA, RIKEN full-length enriched library,
DE   clone:I730025K17 product:ribosomal protein L27a, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-514
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 68941d1a17fe1c08983e9c602ca0d67b.
DR   Ensembl-Gn; ENSMUSG00000046364; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031981; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000143107; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084463; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I730025K17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..514
FT                   /organism="Mus musculus"
FT                   /strain="DBA/2"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I730025K17"
FT                   /cell_line="CRL-1722 L5178Y-R"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        25..471
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="ribosomal protein L27a (MGD|MGI:1347076
FT                   GB|NM_011975, evidence: BLASTN, 100%, match=508)"
FT                   /db_xref="GOA:P14115"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="MGI:MGI:1347076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14115"
FT                   /protein_id="BAE39822.1"
FT                   /translation="MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINF
FT                   DKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA"
FT   regulatory      490..495
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      514
FT                   /note="putative"
XX
SQ   Sequence 514 BP; 139 A; 132 C; 139 G; 104 T; 0 other;
     gccttttccc tttctgccac cgccatgcca tccagactga ggaagacccg gaaactccgg        60
     ggccacgtga gccacggcca cggccgcatc ggtaagcacc gcaagcaccc aggcggccgc       120
     gggaatgctg gaggcatgca ccaccacagg atcaactttg acaaatatca cccaggttac       180
     tttgggaaag ttggtatgcg gcattaccac ttgaagagga accagagctt ctgcccaaca       240
     gtcaacctgg ataaactgtg gacattggtc agcgagcaga cacgggtcaa tgcggcaaaa       300
     aacaagactg gagttgctcc catcattgat gttgttcgat caggctacta caaagttctg       360
     ggcaagggaa agctccctaa gcaacctgtc atcgtgaagg ccaaattctt cagcagaaga       420
     gctgaggaga agattaaggg tgttggaggt gcctgtgttc tggtggctta aaagccacac       480
     cggaggttaa ttaaatgcta acattttcga tgcg                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page