(data stored in ACNUC10243 zone)

EMBL: AK169663

ID   AK169663; SV 1; linear; mRNA; HTC; MUS; 1872 BP.
XX
AC   AK169663;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430005C18 product:Heterogeneous nuclear
DE   ribonucleoprotein A3 homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1872
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8709875a70629359f2780c924ebc5d09.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000090792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111964; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430005C18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1872
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430005C18"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        42..1181
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Heterogeneous nuclear ribonucleoprotein A3 homolog
FT                   [Homo sapiens] (UniProt|AAQ63629, evidence: FASTY, 99.7%ID,
FT                   100%length, match=1137)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5FB19"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FB19"
FT                   /protein_id="BAE41285.1"
FT                   /translation="MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGP
FT                   GYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQ
FT                   QSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
FT   regulatory      1850..1855
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1872
FT                   /note="putative"
XX
SQ   Sequence 1872 BP; 551 A; 266 C; 539 G; 516 T; 0 other;
     gatattgaac tcgagttgga agaggcgagt ccggtctcaa aatggaggta aaaccgccgc        60
     ccggtcgccc ccagcctgac tccggccgtc gccgccgccg ccggggggag gagggccatg       120
     atccaaagga accagagcag ctgaggaagc tatttattgg tggtctgagc tttgaaacca       180
     cagatgatag cttaagagaa cattttgaga aatggggcac acttacagac tgtgtggtaa       240
     tgagagatcc ccaaacaaaa cgttccagag gctttggttt tgtgacctac tcttgtgttg       300
     aagaggtgga tgctgcaatg tgtgctcggc cacacaaggt tgatgggcgt gtggtggaac       360
     cgaagagagc tgtttctaga gaggattctg taaagcctgg tgcccattta acggtgaaga       420
     aaatttttgt tggtggtatt aaagaggata cggaagaata taacctgaga gactactttg       480
     aaaagtatgg caagattgaa accatagagg ttatggaaga caggcagagt gggaaaaaga       540
     gaggatttgc ttttgtaact tttgatgatc atgacacagt tgataaaatt gttgttcaga       600
     aataccacac tattaatggg cataattgtg aagtgaaaaa ggccctttct aaacaagaga       660
     tgcagtctgc tggatcacag agaggtcgtg gaggtggatc tggcaacttt atgggtcgtg       720
     gaggaaactt tggaggtggt ggaggaaact ttggtcgtgg aggaaacttt ggtggaagag       780
     gtggctatgg tggtggaggt ggtggcagca gaggtagtta tggaggtggt gatggtggat       840
     ataatggatt tggaggtgat ggtggcaact atggtggtgg tcctggttac agcagtagag       900
     gaggttatgg aggtggtgga ccaggatatg gaaaccaggg tggtggatat ggtggtggag       960
     gaggaggcta tgatggttac aatgaaggag gaaattttgg tggaggtaac tatggtggtg      1020
     gtggaaacta taatgacttt ggaaattata gtggacagca acaatcaaat tatggaccca      1080
     tgaagggggg cagttttggt ggaagaagct caggcagtcc ctatggtggt ggctatggat      1140
     ctggaggtgg aagtggagga tatggtagca gaaggtttta aaataaaaca gaaacggcta      1200
     cagttcttag caggagagag agcgaggagt tgtcaggaaa gctgcaggtt actttgagac      1260
     agtcgtccca aatgcattag aggaactgta aaaatctgcc acagaaggaa cgataatcca      1320
     tagtcagaaa agttactgca gcttaaacag gaaacccttc ttgttcagga ctgtcatagc      1380
     cacagtttgc aaaaagtgca gctattgatt aatgcaatgt agtgtcaatt agatgtacat      1440
     tcctgaggtc ttttatctgt tgtagctttg tctttttctt tttcttttca ttacatcagg      1500
     tatattgccc tgtaaattgt ggtagtggta ccaggaataa aaaaattaag gaatttttaa      1560
     cttttcaata tttgtgtagt tcagtttttc tacattttag tacagaaact ttaacaaaat      1620
     gcagtttcga aggtgtttcc ttgtgagtta acacgtgaag aagatcattg ttaattacta      1680
     ttttgtatga attttgctaa agttaactgt aaagaaacac ctactgactt gcaatttaag      1740
     gggaatctat tctccccatt tccaaaacaa tgatgaatgg gcgctgacat gtggagagaa      1800
     tagatatttg tatgtttgca atgtgtgttt tagataatta gaattgggaa ataaaaaaat      1860
     agcatatttg cg                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page