(data stored in ACNUC9543 zone)

EMBL: AK170034

ID   AK170034; SV 1; linear; mRNA; HTC; MUS; 4428 BP.
XX
AC   AK170034;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630011C03 product:calpain 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4428
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c96d7a9fd63076ff233295a395b1b82f.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630011C03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4428
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630011C03"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        199..2121
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calpain 5 (MGD|MGI:1100859 GB|NM_007602, evidence:
FT                   BLASTN, 99%, match=4410)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TDS7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR033883"
FT                   /db_xref="InterPro:IPR033884"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="MGI:MGI:1100859"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDS7"
FT                   /protein_id="BAE41522.1"
FT                   /translation="MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTP
FT                   GPTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDW
FT                   KEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALV
FT                   EKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVH
FT                   SRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIR
FT                   LRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKC
FT                   RLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPED
FT                   EVLISIQQRPKRSTRREGKGENLAIGFNIYKVEENRQYRMHSLQHKAASSIYINSRSVF
FT                   LRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQ
FT                   VAQVHVLGAAGLKDTPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQP
FT                   ITVQVWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCSA
FT                   SLTAV"
FT   regulatory      4408..4413
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4428
FT                   /note="putative"
XX
SQ   Sequence 4428 BP; 961 A; 1282 C; 1187 G; 998 T; 0 other;
     gagactgaag cccgggggtc caagttccaa cccccgcctg cgggctgccg gggtatcatc        60
     tccccgcaga gtcccaggct gtggcgcggg ctggtctagc ctccgctcca gtgcccgcac       120
     tgtgctctgc atcccgggag tccagctcca gctgcggcga cgcggcaggt gcctcccctt       180
     cttggggacg tggtcaccat gttctcctgc gcgaaggcct atgaggacca gaactactcg       240
     gcgctgaagc gggcctgcct gcgcaagaag gtgctgttcg aggatcccct cttccctgcc       300
     accgacgact ccctttacta taagggcacc ccagggccca cagtcaggtg gaagcggcct       360
     aaggatatct gcgacgatcc ccggctcttc gtagatggca tcagctccca tgacctgcac       420
     cagggccagg tgggcaactg ctggtttgtg gctgcctgct catcactggc ctcccgagag       480
     tcactctggc agaaggtcat cccagactgg aaggagcagg aatggaaccc cgagaagcct       540
     gacagctatg ctggcatctt ccacttcaac ttctggcgct ttggggagtg ggtggacgta       600
     atcgtcgatg accggctgcc cacagtcaac aaccagctca tttactgcca ttccaactcc       660
     aaaaatgagt tctggtgtgc cctggtggag aaggcctatg ccaagctggc cggctgttac       720
     caggccctgg acggaggcaa cacggccgat gcattggtgg atttcacagg tggtgtttct       780
     gaacccattg acctgaccga gggggacttg gccactgacg aggctaagag gaatcagctc       840
     tttgagcgag tgctgaaggt gcacagcaga ggcgggctca tcagtgcctc catcaaggct       900
     gtgacagcag ctgacatgga ggcccgcctg gcatgtggcc tggtgaaggg ccatgcatac       960
     gctgtcaccg atgtgcgcaa ggtgcgcctg ggccatggcc tgctggcctt cttcaagtca      1020
     gagaagcttg atatgatccg tctgaggaac ccctggggcg agcgggagtg gacggggccc      1080
     tggagtgaca cgtcagagga atggcagaaa gtgagcaaga gtgagaggga gaagatgggc      1140
     gtgaccgtgc aggatgatgg ggaattctgg atgacctttg aggacatgtg ccggtacttt      1200
     actgacatca ttaaatgccg cctgattaac acgtcctacc tgagcatcca taagacatgg      1260
     gaggaggccc ggctgcatgg tgcctggacg agacatgagg acccacagca gaaccgcagt      1320
     ggaggctgca tcaaccacaa ggacactttc ttccagaacc cacagtacgt atttgaagtc      1380
     aagaagccag aagatgaagt gttgatcagt atccagcagc ggccgaagcg ctcaactcgc      1440
     cgggagggca aaggcgagaa tctggccatt ggcttcaaca tctataaggt ggaagagaac      1500
     cgccaatacc gtatgcacag cctacagcat aaggccgcca gctccatcta catcaattcc      1560
     cgcagcgttt ttttgaggac agagctgccc gagggccgct acgttatcat ccctaccacc      1620
     tttgagccag gccacactgg cgagttcctg ctccgagtct tcacagatgt cccctccaac      1680
     tgccgggaac tacgcctgga tgagccccct cggacctgtt ggagttccct ctgtggctac      1740
     cctcagcagg tggcccaggt acatgtcctg ggggctgctg gcctcaagga caccccaaca      1800
     ggagcaaact catatgtgat catcaagtgt gagggcgaaa aggttcgctc agctgtgcag      1860
     agagggacct cgacaccaga gtacaatgta aaaggcatct tctatcgcaa gaagctggct      1920
     cagcctatca ccgtgcaggt ttggaatcac cgagtcctga aggatgaatt cctgggccag      1980
     gtgcacctga agactgcccc ggatgacctg caggacctcc acaccctcca tctccaggac      2040
     cgcagtagcc ggcagcccag tgacctgcca ggcattgtag ctgtgcgagt cctctgcagt      2100
     gcctctctca cggctgtctg accccagcct gcctgtcctg ccccactagt cctcaccact      2160
     actcgcatgt ccccaccttg cctgggacca gcctgggaac cagacactgg ggccctttcc      2220
     tcactcttcc actgacccac tgtgtgacct gaagagagcc ctgccctctc tgagcctcag      2280
     tgtttggagg gccccaaaga attcccgtct tgtgggggag ttttcttgcc taagatttaa      2340
     tgcagttctc tctacccagt gggcgctgct gttaaggggc catctgctga aaacgtttcc      2400
     ccaggccctg ctgtctgcca ggagtgccaa gtgtcaactg tttacacaca aactgccatg      2460
     tcccacgccc cttccctctc cttgtttgct atgggggaga ttgcttccct ccccagatct      2520
     ttgctatgta gcttagagtg accttaaact tatgatcccc ctgcctccac ctcctcaatg      2580
     ccgtaccact ataccagttt gagtggtgct gggtatggaa cccagggctt tgtgcatgct      2640
     aggcgagcac ttaccaactg agctacatcc ccaatcccac tacagcccat tttaaaacca      2700
     tcttgaaaga acccttattg gcatatgcag gagacatctg ctcattgtct aatgcctgac      2760
     ccccattcat ttagttattc aatatagact tgcccaatta gcccatcgag cctccctagg      2820
     cttcccgatt ctcaggtctt ctcggaggca gatcccttcc tgagctccag gctctgactt      2880
     caccgtcacc ctctgaagag ctatgatcat gctggtgaga aagtatgatt tcccaacctc      2940
     tgcttgtggt gttggaagga gtggcctggc caggcaggtt gatgtaaggc tatgggagac      3000
     ccagggggaa cacatgctgc ctctgctgaa agaccctggg tttttcttgg aagaaaggac      3060
     tctagggtgg ttggtaccag gccttcaggg ttagatcatc tgtcgagtgt caccgatggg      3120
     gacttctcat gaccagaggg ctctgcacca gcatccccaa agagccaaga aggccaccat      3180
     gcttttaatg tccagaccaa aatgttgctc tcaatcccca acatttgata gtcttagcat      3240
     ttaaacaaaa tctccgagtg agggaggcca gcccccacat ttgtcctctg caggctcatt      3300
     ttgttgagcg tctgctttta tcttgacact gagcacgaga gggcacgggt gggtgctcac      3360
     agtgggacct tcttggagga atctcagagg gggacagaga tgagatgtgc attcctggct      3420
     gccacctgca ttcctgagga actcttgttt actggtgctg tggctcacag gtccccctct      3480
     gtgccctcct tcagcttcca ggccagactt agtagataaa tagtaataat aataataata      3540
     caattgagtt atcagccaca attccttttg gaactgttac actctgcctc tggtccctcc      3600
     aacgtggtcc tcttcctggc tggaggtgct ggattctgac tgccatcttg ctccatggtg      3660
     gctcttctgg cctgggaccc ggtccacagg aagggctagg agctgaatta aagatgagag      3720
     catccctcct gcacactggg gcttcccttc accaggagca aatcacttca acctcccgtg      3780
     cctcgtttcc tccctctgta gcatggggct cgagactcct gttggtgagg gactcttaca      3840
     aggataagag caaggccaca ccacttccgc tgtgtatcag tctatcatac actccgcacg      3900
     gtcacatgat cacttcactt ctcgatggct attgcagacc aagactgcag tcaagaaggg      3960
     agggtgagcc tcacgatctt gggtctcagg gcctgacata ggggtcttag ctcagccata      4020
     tccctctgag gcacagggcg agcagggacc aagtagcaga cgagtcgatg cttcacctgg      4080
     catctagcca ctgcctccca cttctagcag aactgggtca gcagccctgt tcttgcttcc      4140
     tctctcttaa gctaggccag gctggctcct ggctgtgaag gaacttccgg tccccaagaa      4200
     gccttgaaga ctggacaagg gaggacaggg tggagcaggg atagccgtgg cttcatttat      4260
     cgtttgcacc caggaggcct tgtagtcttc caattgcagg agatcagccc tacagtgtat      4320
     tctacgtgaa ccaacagggc ctggccttca ctcctccagg ccacaatgcc ctggggtcaa      4380
     gggaaaggaa ctctgttatc ttctcagaat aaatattact gccgctct                   4428
//

If you have problems or comments...

PBIL Back to PBIL home page