(data stored in ACNUC8465 zone)

EMBL: AK171584

ID   AK171584; SV 1; linear; mRNA; HTC; MUS; 1527 BP.
XX
AC   AK171584;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F730313D18 product:mitogen activated protein kinase
DE   kinase 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1527
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9349b3eec834daea9ade466ca786a9ca.
DR   Ensembl-Gn; ENSMUSG00000035027; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017536; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017514; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017476; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017299; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017930; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017271; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017377; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017448; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017397; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016926; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000105331; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026385; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026357; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026325; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026134; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026826; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026182; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025663; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F730313D18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1527
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F730313D18"
FT                   /cell_type="B6-derived CD11 +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        193..1395
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 2
FT                   (MGD|MGI:1346867 GB|BC014830, evidence: BLASTN, 100%,
FT                   match=1517)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91YS7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346867"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YS7"
FT                   /protein_id="BAE42542.1"
FT                   /translation="MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELD
FT                   LDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIH
FT                   LEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAK
FT                   RIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
FT                   MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGR
FT                   PVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSS
FT                   DFQEFVNKCLIKNPAERADLKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTA
FT                   V"
XX
SQ   Sequence 1527 BP; 303 A; 475 C; 478 G; 271 T; 0 other;
     gccctgttcc ccgacctccc ggctgcgctg cagcgtcagc ttcactcggc ctcggcgtcg        60
     gtctgctcgc cccggcgctc cgggctcgtc cgccttccac cttctgcccg gcctaggccg       120
     cagccccggg cccgcgtcgc gccgccccct atgggccccg gctgaggcgt cgccgctggc       180
     cgtggagccc cgatgctggc ccggaggaag ccggtgttac cggcactcac tatcaaccct       240
     accatcgccg agggcccgtc ccccaccagc gagggcgcct ctgaggcaaa cctggtggac       300
     ctccagaaga agctggaaga gctggacctg gatgagcagc aaaggaagcg gctggaggcc       360
     ttccttaccc agaaggctaa ggtcggtgag ctcaaggacg acgactttga gaggatctca       420
     gagctgggtg ccggcaatgg cggagtggtc accaaggccc ggcataggcc gtcaggcctc       480
     atcatggcca gaaagctgat ccacctggag atcaaaccgg ccgtgcgcaa ccagatcatc       540
     cgggagctgc aggtgctgca cgagtgcaac tcgccctaca tcgtgggctt ctatggggcc       600
     ttctacagcg acggcgagat cagcatctgc atggagcaca tggatggtgg ctcactggac       660
     caggtactga aggaggccaa gcggattcct gaagacatct tggggaaggt cagcattgcg       720
     gtgctccggg gcctggccta cctccgagag aagcaccaga tcatgcacag agatgtgaag       780
     ccctccaaca tcctggtgaa ctctcgcggg gagattaagc tgtgtgactt cggggtgagc       840
     ggccagctga tcgactccat ggccaactcg tttgtaggga cgcgctccta catgtcccca       900
     gagcggctgc agggcaccca ctactctgtg cagtcggaca tctggagcat ggggctgtcg       960
     ctggtggagc tggccatcgg gaggtatccc attcccccac ctgatgccaa ggaactagag      1020
     gccagctttg gccggcctgt ggtggacggg gcagacggag aaccccatag tgtctccccg      1080
     aggcccaggc cccctggacg ccccatcagt ggtcatggga tggacagccg accggccatg      1140
     gccatctttg agctgctgga ctacatagtg aacgagccac ctcccaagct gcccagtggt      1200
     gtgttcagct cagacttcca ggagtttgtg aataaatgtc tcattaagaa cccagcagag      1260
     cgagcagatc tgaagctgct gatgaaccac gccttcatca agcgctctga gggggaggaa      1320
     gtggacttcg ccggctggct gtgcagaacc ctgcggctga agcagcccag cacacccacg      1380
     cggactgcag tgtgacagcc agcgcccagc agtctgtgtc cttgtccctg tcggcacagt      1440
     ggccgctgcc tctggggaca gtgatgctgt ttgttgtggc aggggaccta tgcccatgca      1500
     tttgaaaacc aaacaaaatg aagaaag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page