(data stored in ACNUC8465 zone)

EMBL: AK172055

ID   AK172055; SV 1; linear; mRNA; HTC; MUS; 1536 BP.
XX
AC   AK172055;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830033F15 product:mitogen activated protein kinase kinase 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1536
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b7dd4f377bace89a8e13921c42b46970.
DR   Ensembl-Gn; ENSMUSG00000035027; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017536; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017514; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017476; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017299; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017930; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017271; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017377; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017448; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017397; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016926; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000105331; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026385; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026357; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026325; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026134; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026826; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026182; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025663; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830033F15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1536
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830033F15"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        202..1404
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 2
FT                   (MGD|MGI:1346867 GB|BC014830, evidence: BLASTN, 99%,
FT                   match=1517)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91YS7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346867"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YS7"
FT                   /protein_id="BAE42803.1"
FT                   /translation="MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELD
FT                   LDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIH
FT                   LEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAK
FT                   RIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
FT                   MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGR
FT                   PVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSS
FT                   DFQEFVNKCLIKNPAERADLKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTA
FT                   V"
XX
SQ   Sequence 1536 BP; 303 A; 479 C; 483 G; 271 T; 0 other;
     ggtggccgcc ccctgttccc cgacctcccg gctgcgctgc agcgtcagct tcactcggcc        60
     tcggcgtcgg tctgctcgcc ccggcgctcc gggctcgtcc gccttccacc ttctgcccgg       120
     cctaggccgc agcctcgggc ccgcgtcgcg ccgcccccta tgggccccgg ctgaggcgcc       180
     gccgctggcc gtggagcccc gatgctggcc cggaggaagc cggtgttacc ggcactcact       240
     atcaacccta ccatcgccga gggcccgtcc cccaccagcg agggcgcctc tgaggcaaac       300
     ctggtggacc tccagaagaa gctggaagag ctggacctgg atgagcagca aaggaagcgg       360
     ctggaggcct tccttaccca gaaggctaag gtcggtgagc tcaaggacga cgactttgag       420
     aggatatcag agctgggtgc cggcaatggc ggagtggtca ccaaggcccg gcataggccg       480
     tcaggcctca tcatggccag aaagctgatc cacctggaga tcaaaccggc cgtgcgcaac       540
     cagatcatcc gggagctgca ggtgctgcac gagtgcaact cgccctacat cgtgggcttc       600
     tatggggcct tctacagcga cggcgagatc agcatctgca tggagcacat ggatggtggc       660
     tcactggacc aggtactgaa ggaggccaag cggattcctg aagacatctt ggggaaggtc       720
     agcattgcgg tgctccgggg cctggcctac ctccgagaga agcaccagat catgcacaga       780
     gatgtgaagc cctccaacat cctggtgaac tctcgcgggg agattaagct gtgcgacttc       840
     ggggtgagcg gccagctgat cgactccatg gccaactcgt ttgtagggac gcgctcctac       900
     atgtccccag agcggctgca gggcacccac tactctgtgc agtcggacat ctggagcatg       960
     gggctgtcgc tggtggagct ggccatcggg aggtatccca ttcccccacc tgatgccaag      1020
     gaactagagg ccagctttgg ccggcctgtg gtggacgggg cagacggaga accccatagt      1080
     gtctccccga ggcccaggcc ccctggacgc cccatcagtg gtcatgggat ggacagccga      1140
     ccggccatgg ccatctttga gctgctggac tacatagtga acgagccacc tcccaagctg      1200
     cccagtggtg tgttcagctc agacttccag gagtttgtga ataaatgtct cattaagaac      1260
     ccagcagagc gagcagatct gaagctgctg atgaaccacg ccttcatcaa gcgctctgag      1320
     ggggaggaag tggacttcgc cggctggctg tgcagaaccc tgcggctgaa gcagcccagc      1380
     acacccacgc ggactgcagt gtgacagcca gcgcccagca gtctgtgtcc ttgtccctgt      1440
     cggcacagtg gccgctgcct ctggggacag tgatgctgtt tgttgtggca ggggacctgt      1500
     gcccatgcat ttgaaaacca aacaaaatga agaaag                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page