(data stored in ACNUC1829 zone)

EMBL: AK172481

ID   AK172481; SV 1; linear; mRNA; HTC; MUS; 1282 BP.
XX
AC   AK172481;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830209M05 product:transmembrane 4 superfamily member 7, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1282
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 807d987cb6e525284b03562d6abf9e48.
DR   Ensembl-Gn; ENSMUSG00000025511; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033217; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032263; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032905; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033010; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033043; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032373; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117634; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087662; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087382; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087226; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086282; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830209M05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1282
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830209M05"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        98..814
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transmembrane 4 superfamily member 7
FT                   (MGD|MGI:1928097 GB|BC003482, evidence: BLASTN, 99%,
FT                   match=1237)"
FT                   /db_xref="GOA:Q4FJW7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJW7"
FT                   /protein_id="BAE43029.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 1282 BP; 255 A; 347 C; 370 G; 310 T; 0 other;
     ggggggcagt gggggcctgt gagtcactgt ggcctgggat caggctcaag atctggactg        60
     aagactgctg gtggccagag agctgaagcg ctgcagcatg gcgcgcggct gcctccaggg       120
     cgtcaagtac ctcatgttcg ccttcaacct gctcttctgg ctgggtggct gtggtgtcct       180
     gggtgttggc atctggttgg ctgccacaca gggaaacttt gccaccttat catcctcatt       240
     tccatccttg tcggctgcca acctgctcat cgtcaccggg accttcgtca tggccatcgg       300
     cttcgtgggc tgcattgggg ccctcaagga gaacaagtgc ctactgctca ctttctttgt       360
     gctgctgctg ctagtgttcc tgctggaagc caccattgct gtgctcttct ttgcctacag       420
     tgacaagatt gacagttatg cccaacaaga cctgaagaag ggcctgcatc tgtatggcac       480
     acagggcaac gtgggcctca ccaatgcctg gagcatcatc cagactgatt tccgatgctg       540
     tggagtttcc aattacactg attggtttga ggtatacaat gccactcgtg tgcctgactc       600
     ctgctgtctg gagttcagtg atagctgtgg gttacatgaa cctggtacct ggtggaagtc       660
     gccctgttat gagacagtga aggcctggct ccaggagaac ctgctagctg tgggcatctt       720
     tggactgtgc acggcactgg tgcagattct gggcctcacc ttcgctatga ccatgtactg       780
     ccaggtggta aaggcggaca cctactgtgc ataggtctca cagcctctgc ttctctgcca       840
     aaggacccgc ccacgggaag gaagatgtcc aaacccgctc cccctgcagg actggtgttc       900
     tgctgaatgc agggggaaga gctggaggcc agagcaccca gcatccatcc ctgcacctga       960
     gggcactctg cttgggtggc agcagacacc agactataga gttggtgcca aatggcaccc      1020
     agggctaagg gcccagggaa ctttgacact ttttatatcc atatatacct tccagtgttc      1080
     acacaggatg gggttcccag ccttgcatgg ttgctaggtt gggggcaggc ccagtctgct      1140
     caaggcccac gatgatcttg gtgctccagg cagggccagg tcccatgatc cacattccat      1200
     gacagtgtcg tggttccaga tgcatcttaa taaagtgtgt gagcagactg tgggtcttgc      1260
     caacacacaa aggttgtaca gc                                               1282
//

If you have problems or comments...

PBIL Back to PBIL home page