(data stored in ACNUC13479 zone)

EMBL: AK175776

ID   AK175776; SV 1; linear; mRNA; STD; PLN; 1509 BP.
XX
AC   AK175776;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-35-G15.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1509
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (06-SEP-2004) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@gsc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; afaea5f1276fd221dc9e4e045d80d340.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145). cDNA cleaved with BamHI
CC   and XhoI was ligated to modified Lambda FLC-1-E vector (Carninci et
CC   al. (2001) Genomics 77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1509
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL22-35-G15"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        71..1387
FT                   /codon_start=1
FT                   /gene="At5g01010"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /protein_id="BAD43539.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
XX
SQ   Sequence 1509 BP; 426 A; 322 C; 356 G; 405 T; 0 other;
     gcttggcttg gcggtggcat ggagctctgg atttgtgtgt gagtgagtag atcgcgcaaa        60
     gaatctgaaa atggcgtcaa cggaaggcct tatgcctatc acccgggctt ttctcgcttc       120
     ttactacgac aaatatcctt tctctcctct ttccgacgac gtttctcggc tttcctctga       180
     catggcatct ctgattaagc tattgaccgt ccaatctccc ccttcacaag gggaaacttc       240
     cctgattgac gaagcaaacc gtcagccccc tcacaaaatt gatgagaata tgtggaaaaa       300
     tagggagcag atggaggaga tactgtttct tctgtcacca tctcgctggc ctgttcagct       360
     tcgggaacct tccacatccg aagatgctga attcgcttct attttgcgga ctctcaagga       420
     cagttttgat aacgcattca ctgctatgat ttccttccag acgaagaatt ccgagcgcat       480
     attcagcaca gtaatgacct acatgcctca agatttccgg ggaacgctca tcagacagca       540
     gaaggagagg tcggagagga acaaacaggc ggaggttgat gcgttggtca gctctggagg       600
     gagcatacgc gacacatatg ctcttctttg gaagcagcaa atggagagga ggaggcagtt       660
     ggctcagcta ggctctgcca ctggtgtcta caaaaccctg gtcaagtact tggtaggggt       720
     tccacaggtg ttgttggatt ttattcgaca aataaacgat gatgatgggc caatggaaga       780
     acagcgagaa cgttatggac cccctctata cagtctcaca aaaatggtga tcgcaattcg       840
     ggttttccta acacttctgt gggaaagata tgataccttc aaactgagta aagaccaaat       900
     gaatctcctg tctgaagctg ctatagtcta cacttctgag tttgaaagat tcgtcacatt       960
     tatcagcgat gtattcgcca attccccctt ctttatttca gctgatacag ctggcatatt      1020
     gtggtcaagg gacaatgagg agtacaagga gataatcgtt caagctggga gaacctatga      1080
     gatctcattg atggtggaat ctgaaaattc gtatattgct tgggatttct ctttgatgca      1140
     aggcaagata agcatggata tcggatttag cgtggagtac ataaatgctt caggggaaaa      1200
     gactctgata ttaccttacc gtcggtatga agctgaccag ggcaacttct ctacgctaat      1260
     ggctggaaac tacaaacttg tttgggataa ttcatattca actttcttca aaaagactct      1320
     tcgatataag gtggattgca tagcaccagt agtggagccg gatccagagc cggagccgtt      1380
     aaactgaaag tggaagatga aggtggattt tacagtcatg aacactcatc atttctttgt      1440
     aaaacgataa aactctgaac cctttgaaat acatcaatgg aacttaaata tgtgctacca      1500
     aaaaaaaaa                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page