(data stored in ACNUC13479 zone)

EMBL: AK176023

ID   AK176023; SV 1; linear; mRNA; STD; PLN; 1561 BP.
XX
AC   AK176023;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-73-I07.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1561
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (06-SEP-2004) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@gsc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 2595030ba42ea8bd5b33fa3c2460f918.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145). cDNA cleaved with BamHI
CC   and XhoI was ligated to modified Lambda FLC-1-E vector (Carninci et
CC   al. (2001) Genomics 77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1561
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL22-73-I07"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        117..1433
FT                   /codon_start=1
FT                   /gene="At5g01010"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /protein_id="BAD43786.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
XX
SQ   Sequence 1561 BP; 441 A; 334 C; 367 G; 419 T; 0 other;
     ggtcataatc aataagtctt cttcttcgcc ggcagagaga gaatttgctt ggcttggcgg        60
     tggcatggag ctctggattt gtgtgtgagt gagtagatcg cgcaaagaat ctgaaaatgg       120
     cgtcaacgga aggccttatg cctatcaccc gggcttttct cgcttcttac tacgacaaat       180
     atcctttctc tcctctttcc gacgacgttt ctcggctttc ctctgacatg gcatctctga       240
     ttaagctatt gaccgtccaa tctccccctt cacaagggga aacttccctg attgacgaag       300
     caaaccgtca gccccctcac aaaattgatg agaatatgtg gaaaaatagg gagcagatgg       360
     aggagatact gtttcttctg tcaccatctc gctggcctgt tcagcttcgg gaaccttcca       420
     catccgaaga tgctgaattc gcttctattt tgcggactct caaggacagt tttgataacg       480
     cattcactgc tatgatttcc ttccagacga agaattccga gcgcatattc agcacagtaa       540
     tgacctacat gcctcaagat ttccggggaa cgctcatcag acagcagaag gagaggtcgg       600
     agaggaacaa acaggcggag gttgatgcgt tggtcagctc tggagggagc atacgcgaca       660
     catatgctct tctttggaag cagcaaatgg agaggaggag gcagttggct cagctaggct       720
     ctgccactgg tgtctacaaa accctggtca agtacttggt aggggttcca caggtgttgt       780
     tggattttat tcgacaaata aacgatgatg atgggccaat ggaagaacag cgagaacgtt       840
     atggaccccc tctatacagt ctcacaaaaa tggtgatcgc aattcgggtt ttcctaacac       900
     ttctgtggga aagatatgat accttcaaac tgagtaaaga ccaaatgaat ctcctgtctg       960
     aagctgctat agtctacact tctgagtttg aaagattcgt cacatttatc agcgatgtat      1020
     tcgccaattc ccccttcttt atttcagctg atacagctgg catattgtgg tcaagggaca      1080
     atgaggagta caaggagata atcgttcaag ctgggagaac ctatgagatc tcattgatgg      1140
     tggaatctga aaattcgtat attgcttggg atttctcttt gatgcaaggc aagataagca      1200
     tggatatcgg atttagcgtg gagtacataa atgcttcagg ggaaaagact ctgatattac      1260
     cttaccgtcg gtatgaagct gaccagggca acttctctac gctaatggct ggaaactaca      1320
     aacttgtttg ggataattca tattcaactt tcttcaaaaa gactcttcga tataaggtgg      1380
     attgcatagc accagtagtg gagccggatc cagagccgga gccgttaaac tgaaagtgga      1440
     agatgaaggt ggattttaca gtcatgaaca ctcatcattt ctttgtaaaa cgataaaact      1500
     ctgaaccctt tgaaatacat caatggaact taaatatctg ctaccaggaa caaaacaaaa      1560
     a                                                                      1561
//

If you have problems or comments...

PBIL Back to PBIL home page