(data stored in ACNUC13479 zone)

EMBL: AK176250

ID   AK176250; SV 1; linear; mRNA; STD; PLN; 1508 BP.
XX
AC   AK176250;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA, complete cds, clone: RAFL23-14-M15.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1508
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (06-SEP-2004) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@gsc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 63a6575b8c28bc09edd1de5bb4135f80.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145). cDNA cleaved with BamHI
CC   and XhoI was ligated to modified Lambda FLC-1-E vector (Carninci et
CC   al. (2001) Genomics 77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1508
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL23-14-M15"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        70..1386
FT                   /codon_start=1
FT                   /gene="At5g01010"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /protein_id="BAD44013.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
XX
SQ   Sequence 1508 BP; 426 A; 323 C; 355 G; 404 T; 0 other;
     gcttggcttg gcggtggcag gagctctgga tttgtgtgtg agtgagtaga tcgcgcaaag        60
     aatctgaaaa tggcgtcaac ggaaggcctt atgcctatca cccgggcttt tctcgcttct       120
     tactacgaca aatatccttt ctctcctctt tccgacgacg tttctcggct ttcctctgac       180
     atggcatctc tgattaagct attgaccgtc caatctcccc cttcacaagg ggaaacttcc       240
     ctgattgacg aagcaaaccg tcagccccct cacaaaattg atgagaatat gtggaaaaat       300
     agggagcaga tggaggagat actgtttctt ctgtcaccat ctcgctggcc tgttcagctt       360
     cgggaacctt ccacatccga agatgctgaa ttcgcttcta ttttgcggac tctcaaggac       420
     agttttgata acgcattcac tgctatgatt tccttccaga cgaagaattc cgagcgcata       480
     ttcagcacag taatgaccta catgcctcaa gatttccggg gaacgctcat cagacagcag       540
     aaggagaggt cggagaggaa caaacaggcg gaggttgatg cgttggtcag ctctggaggg       600
     agcatacgcg acacatatgc tcttctttgg aagcagcaaa tggagaggag gaggcagttg       660
     gctcagctag gctctgccac tggtgtctac aaaaccctgg tcaagtactt ggtaggggtt       720
     ccacaggtgt tgttggattt tattcgacaa ataaacgatg atgatgggcc aatggaagaa       780
     cagcgagaac gttatggacc ccctctatac agtctcacaa aaatggtgat cgcaattcgg       840
     gttttcctaa cacttctgtg ggaaagatat gataccttca aactgagtaa agaccaaatg       900
     aatctcctgt ctgaagctgc tatagtctac acttctgagt ttgaaagatt cgtcacattt       960
     atcagcgatg tattcgccaa ttcccccttc tttatttcag ctgatacagc tggcatattg      1020
     tggtcaaggg acaatgagga gtacaaggag ataatcgttc aagctgggag aacctatgag      1080
     atctcattga tggtggaatc tgaaaattcg tatattgctt gggatttctc tttgatgcaa      1140
     ggcaagataa gcatggatat cggatttagc gtggagtaca taaatgcttc aggggaaaag      1200
     actctgatat taccttaccg tcggtatgaa gctgaccagg gcaacttctc tacgctaatg      1260
     gctggaaact acaaacttgt ttgggataat tcatattcaa ctttcttcaa aaagactctt      1320
     cgatataagg tggattgcat agcaccagta gtggagccgg atccagagcc ggagccgtta      1380
     aactgaaagt ggaagatgaa ggtggatttt acagtcatga acactcatca tttctttgta      1440
     aaacgataaa actctgaacc ctttgaaata catcaatgga acttaaatat ctgctaccaa      1500
     aaaaaaaa                                                               1508
//

If you have problems or comments...

PBIL Back to PBIL home page