(data stored in ACNUC13479 zone)

EMBL: AK176336

ID   AK176336; SV 1; linear; mRNA; STD; PLN; 1525 BP.
XX
AC   AK176336;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA, complete cds, clone: RAFL24-01-F11.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1525
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (06-SEP-2004) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@gsc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 1764cc318d618c2b5b863d3dd55e4f67.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145). cDNA cleaved with BamHI
CC   and XhoI was ligated to modified Lambda FLC-1-E vector (Carninci et
CC   al. (2001) Genomics 77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1525
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL24-01-F11"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        84..1400
FT                   /codon_start=1
FT                   /gene="At5g01010"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /protein_id="BAD44099.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
XX
SQ   Sequence 1525 BP; 431 A; 323 C; 360 G; 411 T; 0 other;
     ttgtagagaa tttgcttggc ttggcggtgg catggagctc tggatttgtg tgtgagtgag        60
     tagatcgcgc aaagaatctg aaaatggcgt caacggaagg ccttatgcct atcacccggg       120
     cttttctcgc ttcttactac gacaaatatc ctttctctcc tctttccgac gacgtttctc       180
     ggctttcctc tgacatggca tctctgatta agctattgac cgtccaatct cccccttcac       240
     aaggggaaac ttccctgatt gacgaagcaa accgtcagcc ccctcacaaa attgatgaga       300
     atatgtggaa aaatagggag cagatggagg agatactgtt tcttctgtca ccatctcgct       360
     ggcctgttca gcttcgggaa ccttccacat ccgaagatgc tgaattcgct tctattttgc       420
     ggactctcaa ggacagtttt gataacgcat tcactgctat gatttccttc cagacgaaga       480
     attccgagcg catattcagc acagtaatga cctacatgcc tcaagatttc cggggaacgc       540
     tcatcagaca gcagaaggag aggtcggaga ggaacaaaca ggcggaggtt gatgcgttgg       600
     tcagctctgg agggagcata cgcgacacat atgctcttct ttggaagcag caaatggaga       660
     ggaggaggca gttggctcag ctaggctctg ccactggtgt ctacaaaacc ctggtcaagt       720
     acttggtagg ggttccacag gtgttgttgg attttattcg acaaataaac gatgatgatg       780
     ggccaatgga agaacagcga gaacgttatg gaccccctct atacagtctc acaaaaatgg       840
     tgatcgcaat tcgggttttc ctaacacttc tgtgggaaag atatgatacc ttcaaactga       900
     gtaaagacca aatgaatctc ctgtctgaag ctgctatagt ctacacttct gagtttgaaa       960
     gattcgtcac atttatcagc gatgtattcg ccaattcccc cttctttatt tcagctgata      1020
     cagctggcat attgtggtca agggacaatg aggagtacaa ggagataatc gttcaagctg      1080
     ggagaaccta tgagatctca ttgatggtgg aatctgaaaa ttcgtatatt gcttgggatt      1140
     tctctttgat gcaaggcaag ataagcatgg atatcggatt tagcgtggag tacataaatg      1200
     cttcagggga aaagactctg atattacctt accgtcggta tgaagctgac cagggcaact      1260
     tctctacgct aatggctgga aactacaaac ttgtttggga taattcatat tcaactttct      1320
     tcaaaaagac tcttcgatat aaggtggatt gcatagcacc agtagtggag ccggatccag      1380
     agccggagcc gttaaactga aagtggaaga tgaaggtgga ttttacagtc atgaacactc      1440
     atcatttctt tgtaaaacga taaaactctg aaccctttga aatacatcaa tggaacttaa      1500
     atatctgcta ccaggaaaaa aaaaa                                            1525
//

If you have problems or comments...

PBIL Back to PBIL home page