(data stored in ACNUC13479 zone)

EMBL: AK176507

ID   AK176507; SV 1; linear; mRNA; STD; PLN; 1548 BP.
XX
AC   AK176507;
XX
DT   09-SEP-2004 (Rel. 81, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA, complete cds, clone: RAFL25-02-M11.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1548
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (06-SEP-2004) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@gsc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
RA   Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
RA   Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
RA   Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 7bbfe77fd2fb66f6e443c25193fd5f6f.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145). cDNA cleaved with BamHI
CC   and XhoI was ligated to modified Lambda FLC-1-E vector (Carninci et
CC   al. (2001) Genomics 77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1548
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL25-02-M11"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        120..1436
FT                   /codon_start=1
FT                   /gene="At5g01010"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /protein_id="BAD44270.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
XX
SQ   Sequence 1548 BP; 438 A; 329 C; 364 G; 417 T; 0 other;
     gtcgatcata atcaataagt cttcttcttc gccggcagag agagaatttg cttggcttgg        60
     cggtggcatg gagctctgga tttgtgtgtg agtgagtaga tcgcgcaaag aatctgaaaa       120
     tggcgtcaac ggaaggcctt atgcctatca cccgggcttt tctcgcttct tactacgaca       180
     aatatccttt ctctcctctt tccgacgacg tttctcggct ttcctctgac atggcatctc       240
     tgattaagct attgaccgtc caatctcccc cttcacaagg ggaaacttcc ctgattgacg       300
     aagcaaaccg tcagccccct cacaaaattg atgagaatat gtggaaaaat agggagcaga       360
     tggaggagat actgtttctt ctgtcaccat ctcgctggcc tgttcagctt cgggaacctt       420
     ccacatccga agatgctgaa ttcgcttcta ttttgcggac tctcaaggac agttttgata       480
     acgcattcac tgctatgatt tccttccaga cgaagaattc cgagcgcata ttcagcacag       540
     taatgaccta catgcctcaa gatttccggg gaacgctcat cagacagcag aaggagaggt       600
     cggagaggaa caaacaggcg gaggttgatg cgttggtcag ctctggaggg agcatacgcg       660
     acacatatgc tcttctttgg aagcagcaaa tggagaggag gaggcagttg gctcagctag       720
     gctctgccac tggtgtctac aaaaccctgg tcaagtactt ggtaggggtt ccacaggtgt       780
     tgttggattt tattcgacaa ataaacgatg atgatgggcc aatggaagaa cagcgagaac       840
     gttatggacc ccctctatac agtctcacaa aaatggtgat cgcaattcgg gttttcctaa       900
     cacttctgtg ggaaagatat gataccttca aactgagtaa agaccaaatg aatctcctgt       960
     ctgaagctgc tatagtctac acttctgagt ttgaaagatt cgtcacattt atcagcgatg      1020
     tattcgccaa ttcccccttc tttatttcag ctgatacagc tggcatattg tggtcaaggg      1080
     acaatgagga gtacaaggag ataatcgttc aagctgggag aacctatgag atctcattga      1140
     tggtggaatc tgaaaattcg tatattgctt gggatttctc tttgatgcaa ggcaagataa      1200
     gcatggatat cggatttagc gtggagtaca taaatgcttc aggggaaaag actctgatat      1260
     taccttaccg tcggtatgaa gctgaccagg gcaacttctc tacgctaatg gctggaaact      1320
     acaaacttgt ttgggataat tcatattcaa ctttcttcaa aaagactctt cgatataagg      1380
     tggattgcat agcaccagta gtggagccgg atccagagcc ggagccgtta aactgaaagt      1440
     ggaagatgaa ggtggatttt acagtcatga acactcatca tttctttgta aaacgataaa      1500
     actctgaacc ctttgaaata catcaatgga acttaaataa aaaaaaaa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page