(data stored in ACNUC1829 zone)

EMBL: AK223022

ID   AK223022; SV 1; linear; mRNA; STD; HUM; 1112 BP.
XX
AC   AK223022;
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA for transmembrane 4 superfamily member 3 variant, clone:
DE   HSI13179.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1112
RA   Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y.,
RA   Tanaka A., Yokoyama S.;
RT   ;
RL   Submitted (22-APR-2005) to the INSDC.
RL   Akiko Tanaka, RIKEN Yokohama Institute, Protein Research Group; 1-7-22
RL   Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:aktanaka@riken.jp, URL:http://protein.gsc.riken.jp/,
RL   Tel:81-45-503-9452, Fax:81-45-503-9450)
XX
RN   [2]
RX   DOI; 10.1016/0378-1119(94)90802-8.
RX   PUBMED; 8125298.
RA   Maruyama K., Sugano S.;
RT   "Oligo-capping: a simple method to replace the cap structure of eukaryotic
RT   mRNAs with oligoribonucleotides";
RL   Gene 138(1-2):171-174(1994).
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(97)00411-3.
RX   PUBMED; 9373149.
RA   Suzuki Y., Yoshitomo K., Maruyama K., Suyama A., Sugano S.;
RT   "Construction and characterization of a full length-enriched and a
RT   5'-end-enriched cDNA library";
RL   Gene 200(1-2):149-156(1997).
XX
DR   MD5; 5b89904714064ff7a6856b2e341a0dfd.
XX
CC   This work was supported in part by the National Project on Protein
CC   Structural and Functional Analysis, Ministry of Education,
CC   Culture, Sports, Science and Technology of Japan.
CC   Sumio Sugano, Yutaka Suzuki
CC   Laboratory of Functional Genomics Department of Medical Genome
CC   Sciences Graduate School of Frontier Sciences The University of
CC   Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
CC   URL: http://www.k.u-tokyo.ac.jp/index.html.en
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1112
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="HSI"
FT                   /clone="HSI13179"
FT                   /tissue_type="human small intestine"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="this clone is also named as hss001002402"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <108..821
FT                   /codon_start=1
FT                   /product="transmembrane 4 superfamily member 3 variant"
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q53GA9"
FT                   /db_xref="H-InvDB:HIT000330802.8"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:Q53GA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD96742.1"
FT                   /translation="MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGS
FT                   EDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKKSRCMLLLFFIGLLLILLLQVATGI
FT                   LGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGN
FT                   NFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEIL
FT                   GLVFSMVLYCQIGNR"
XX
SQ   Sequence 1112 BP; 358 A; 180 C; 233 G; 341 T; 0 other;
     gtggatacag aaatctctgc aggcaagttg ctccagagca tattgcagga caagcctgta        60
     acgaatagtt aaattcacgg catctggatt cctaatcctt ttccgaaatg gcaggtgtga       120
     gtgcctgtat aaaatattct atgtttacct tcaacttctt gttctggcta tgtggtatct       180
     tgatcctagc attagcaata tgggtacgag taagcaatga ctctcaagca atttttggtt       240
     ctgaagatgt aggctctagc tcctacgttg ctgtggacat attgattgct gtaggtgcca       300
     tcatcatgat tctgggcttc ctgggatgct gcggtgctat aaaaaaaagt cgttgcatgc       360
     ttctgttgtt tttcataggc ttgcttctga tcctgctcct gcaggtggcg acaggtatcc       420
     taggagctgt tttcaaatct aagtctgatc gcattgtgaa tgaaactctc tatgaaaaca       480
     caaagctttt gagcgccaca ggggaaagtg aaaaacaatt ccaggaagcc ataattgtgt       540
     ttcaagaaga gtttaaatgc tgtggtttgg tcaatggagc tgctgattgg ggaaataatt       600
     ttcaacacta tcctgaatta tgtgcctgtc tagataagca gagaccatgc caaagctata       660
     atggaaaaca agtttacaaa gagacctgta tttctttcat aaaagacttc ttggcaaaaa       720
     atttgattat agttattgga atatcatttg gactggcagt tattgagata ctgggtttgg       780
     tgttttctat ggtcctgtat tgccagatcg ggaacagatg aatctgtgga tgcatcaacc       840
     tatcgtcagt caaacccctt taaaatgttg ctttggcttt gtaaatttaa atatgtaagt       900
     gctatataag tcaggagcag ctgtcttttt aaaatgtctc ggctagctag accacagata       960
     tcttctagac atattgaaca catttaagat ttgagggata taagggaaaa tgatatgaat      1020
     gtgtattttt actcaaaata aaagtaactg tttacgttaa aaaaaaaaaa aaaaaaaaaa      1080
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    1112
//

If you have problems or comments...

PBIL Back to PBIL home page