(data stored in ACNUC11016 zone)

EMBL: AK223149

ID   AK223149; SV 1; linear; mRNA; STD; HUM; 1897 BP.
XX
AC   AK223149;
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA for annexin A8 variant, clone: LNG00614.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1897
RA   Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y.,
RA   Tanaka A., Yokoyama S.;
RT   ;
RL   Submitted (22-APR-2005) to the INSDC.
RL   Akiko Tanaka, RIKEN Yokohama Institute, Protein Research Group; 1-7-22
RL   Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:aktanaka@riken.jp, URL:http://protein.gsc.riken.jp/,
RL   Tel:81-45-503-9452, Fax:81-45-503-9450)
XX
RN   [2]
RX   DOI; 10.1016/0378-1119(94)90802-8.
RX   PUBMED; 8125298.
RA   Maruyama K., Sugano S.;
RT   "Oligo-capping: a simple method to replace the cap structure of eukaryotic
RT   mRNAs with oligoribonucleotides";
RL   Gene 138(1-2):171-174(1994).
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(97)00411-3.
RX   PUBMED; 9373149.
RA   Suzuki Y., Yoshitomo K., Maruyama K., Suyama A., Sugano S.;
RT   "Construction and characterization of a full length-enriched and a
RT   5'-end-enriched cDNA library";
RL   Gene 200(1-2):149-156(1997).
XX
DR   MD5; ea9371a38f10b18ed4001aaea822fc5a.
DR   Ensembl-Gn; ENSG00000264230; homo_sapiens.
DR   Ensembl-Tr; ENST00000619162; homo_sapiens.
DR   Ensembl-Tr; ENST00000622769; homo_sapiens.
XX
CC   This work was supported in part by the National Project on Protein
CC   Structural and Functional Analysis, Ministry of Education,
CC   Culture, Sports, Science and Technology of Japan.
CC   Sumio Sugano, Yutaka Suzuki
CC   Laboratory of Functional Genomics Department of Medical Genome
CC   Sciences Graduate School of Frontier Sciences The University of
CC   Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
CC   URL: http://www.k.u-tokyo.ac.jp/index.html.en
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1897
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="LNG"
FT                   /clone="LNG00614"
FT                   /tissue_type="human lung"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="this clone is also named as hss001003003"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <77..1060
FT                   /codon_start=1
FT                   /product="annexin A8 variant"
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q5VT79"
FT                   /db_xref="H-InvDB:HIT000330929.10"
FT                   /db_xref="HGNC:HGNC:23334"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR009115"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5VT79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD96869.1"
FT                   /translation="MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAII
FT                   DVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHD
FT                   AMKGLGTKEGVIIEILASRTKNQLREIMKVYEEDYGSSLEEDIQADTSGYLERILVCLL
FT                   QGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEK
FT                   IANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIV
FT                   SRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP"
XX
SQ   Sequence 1897 BP; 506 A; 499 C; 503 G; 389 T; 0 other;
     agacgtgtgg agtcccagca gaggccaacc tgtgtctctt catctccgtg agaaaggtgc        60
     ccccgaagtg aaagagatgg cctggtggaa agcctggatt gaacaggagg gtgtcacagt       120
     gaagagcagc tcccacttca acccagaccc tgatgcagag accctctaca aagccatgaa       180
     ggggatcggg accaacgagc aggctatcat cgatgtgctc accaagagaa gcaacacgca       240
     gcggcagcag atcgccaagt ccttcaaggc tcagttcggc aaggacctca ctgagacctt       300
     gaagtctgag ctcagtggca agtttgagag gctcattgtg gcccttatgt atccgccata       360
     cagatacgaa gccaaggagc tgcatgacgc catgaagggc ttaggaacca aggagggtgt       420
     catcattgag atcctggcct ctcggaccaa gaaccagctg cgggagataa tgaaggtgta       480
     tgaggaagac tatgggtcca gcctggagga ggacatccaa gcagacacaa gtggctacct       540
     ggagaggatc ctggtgtgcc tcctgcaggg cagcagggat gatgtgagca gctttgtgga       600
     cccggcactg gccctccaag acgcacagga tctgtatgcg gcaggcgaga agattcgtgg       660
     gactgatgag atgaaattca tcaccatcct gtgcacgcgc agtgccactc acctgctgag       720
     agtgtttgaa gagtatgaga aaattgccaa caagagcatt gaggacagca tcaagagtga       780
     gacccatggc tcactggagg aggccatgct cactgtggtg aaatgcaccc aaaacctcca       840
     cagctacttt gcagagagac tctactatgc catgaaggga gcagggacgc gtgatgggac       900
     cctgataaga aacatcgttt caaggagcga gattgactta aatcttatca aatgtcactt       960
     caagaagatg tacggcaaga ccctcagcag catgatcatg gaagacacca gcggcgacta      1020
     caagaacgcc ctgctgagcc tggtgggcag cgacccctga ggcacagaag aacaagagca      1080
     aagaccatga agccagagtc tccaggactc ctcactcaac atcggccatg gacgcaggtt      1140
     gggtgtgagg ggggtcccag cctttcggtc ttctatttcc ctatttccag tgctttccag      1200
     ccgggtttct gacccagagg gtggaaccgg cctggactcc tcttcccaac ttcctccagg      1260
     tcatttccca gtgtgagcac aatgccaacc ttagtgtttc tccagccaga cagatgcctc      1320
     agcatgaagg gcttggggac ttgtggatca ttccttcctc cctgcaggag cttcccaagc      1380
     tggtcacaga gtctcctggg cacaggttat acagacccca gccccattcc catctactga      1440
     aacagggtct ccacaagagg ggccagggaa tatgggtttt taacaagcgt cttacaaaac      1500
     acttctctat catgcagccg gagagctggc tgggagccct tttgttttag aacacacatc      1560
     cttcagcagc tgagaaatga acacgaatcc atcccaaccg agatgccatt aacattcatc      1620
     taaaaatgtt aggctctaaa tggacgaaaa attctctcgc catcttaata acaaaataaa      1680
     ctacaaattc ctgcccaagg acactgtgtt ataagaggcg tgggctcccc tggtggctga      1740
     ccaggtcagc tgccctggcc ttgcacccct ctgcatgcag cacagaaggg tgtgaccatg      1800
     ccctcagcac cactcttgtc cccactgaac ggcaactgag actgggtacc tggagattct      1860
     gaagtgcctt tgctgtggtt ttcaaaataa taaagat                               1897
//

If you have problems or comments...

PBIL Back to PBIL home page