(data stored in ACNUC1829 zone)

EMBL: AK223186

ID   AK223186; SV 1; linear; mRNA; STD; HUM; 1431 BP.
XX
AC   AK223186;
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA for CD151 antigen variant, clone: REC00103.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1431
RA   Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y.,
RA   Tanaka A., Yokoyama S.;
RT   ;
RL   Submitted (22-APR-2005) to the INSDC.
RL   Akiko Tanaka, RIKEN Yokohama Institute, Protein Research Group; 1-7-22
RL   Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:aktanaka@riken.jp, URL:http://protein.gsc.riken.jp/,
RL   Tel:81-45-503-9452, Fax:81-45-503-9450)
XX
RN   [2]
RX   DOI; 10.1016/0378-1119(94)90802-8.
RX   PUBMED; 8125298.
RA   Maruyama K., Sugano S.;
RT   "Oligo-capping: a simple method to replace the cap structure of eukaryotic
RT   mRNAs with oligoribonucleotides";
RL   Gene 138(1-2):171-174(1994).
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(97)00411-3.
RX   PUBMED; 9373149.
RA   Suzuki Y., Yoshitomo K., Maruyama K., Suyama A., Sugano S.;
RT   "Construction and characterization of a full length-enriched and a
RT   5'-end-enriched cDNA library";
RL   Gene 200(1-2):149-156(1997).
XX
DR   MD5; 4a77f23f265b9e8f8b9aeb5d31da0f30.
XX
CC   This work was supported in part by the National Project on Protein
CC   Structural and Functional Analysis, Ministry of Education,
CC   Culture, Sports, Science and Technology of Japan.
CC   Sumio Sugano, Yutaka Suzuki
CC   Laboratory of Functional Genomics Department of Medical Genome
CC   Sciences Graduate School of Frontier Sciences The University of
CC   Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
CC   URL: http://www.k.u-tokyo.ac.jp/index.html.en
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1431
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="REC"
FT                   /clone="REC00103"
FT                   /cell_type="primary epithelial cells of human renal
FT                   proximal tubule"
FT                   /tissue_type="renal proximal tubule"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="this clone is also named as hss001003233"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <88..849
FT                   /codon_start=1
FT                   /product="CD151 antigen variant"
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q53FU5"
FT                   /db_xref="H-InvDB:HIT000330966.9"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q53FU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD96906.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLSV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
XX
SQ   Sequence 1431 BP; 289 A; 445 C; 405 G; 292 T; 0 other;
     gactcggacg cgtggtagcc tagagtcctg gggagcttct gtccacctgt cctgcagagg        60
     agtcgtttcc agcccggctg ccccaggatg ggtgagttca acgagaagaa gacaacatgt       120
     ggcaccgttt gcctcaagta cctgctgttt acctacaatt gctgcttctg gctggctggc       180
     ctggctgtca tggcagtggg catctggacg ctggccctca agagtgacta catcagcctg       240
     ctggcctcag gcacctacct ggccacagcc tacatcctgg tggtggcggg cactgtcgtc       300
     atggtgactg gggtcttggg ctgctgcgcc accttcaagg agcgtcggaa cctgctgcgc       360
     ctgtacttca tcctgctcct catcatcttt ctgctggaga tcatcgctgg tatcctcgcc       420
     tacgcctact accagcagct gaacacggag ctcaaggaga acctgaagga caccatgacc       480
     aagcgctacc accagccggg ccatgaggct gtgaccagcg ctgtggacca gctgcagcag       540
     gagttccact gctgtggcag caacaactca caggactggc gagacagtga gtggatccgc       600
     tcacaggagg ccggtggccg tgtggtccca gacagctgct gcaagacggt ggtggctctt       660
     tgtggacagc gagaccatgc ctccaacatc tacaaggtgg agggcggctg catcaccaag       720
     ttggagacct tcatccagga gcacctgagc gtcattgggg ctgtggggat cggcattgcc       780
     tgtgtgcagg tctttggcat gatcttcacg tgctgcctgt acaggagtct caagctggag       840
     cactactgac cctgccttgg gccttgctgc tgctgcaccc aactactgag ctgagaccac       900
     tgagtaccag gggctgggct ccctgatgac acccaccctg tgccatcacc ataacctctg       960
     gggaccccaa cctcagaggc agcttcaagt gccttttgct gcgcaccaat gcccagcagg      1020
     ggagatgcag gttggaaggg gccttgctga gtggcgcaag gccgagcgtt cccagcaggg      1080
     ggagaaaccc ttcacacccc aggcccttca ggaactgggg ctttgccttg cagccacatg      1140
     gccccatccc agttggggaa gccaggtgag ctctgaccct tgggcctggg cctctgcccc      1200
     tcccaaccca gccgtcgtct ccctcgacag cgcccctgct gtcttcccca ctgcagtcac      1260
     caccacccga aatgccacgt ggtcactgtg cactgccctg ttcatgtgcc tctgcggggc      1320
     agggccttcc tggttttgta cactgctgta cccagatgcc tacaaccatc cctgccacat      1380
     acaggtgctc aataaacact tgtagagcag aaaaaaaaaa aaaaaaaaaa a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page