(data stored in ACNUC8465 zone)

EMBL: AK223490

ID   AK223490; SV 1; linear; mRNA; STD; HUM; 1212 BP.
XX
AC   AK223490;
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA for mitogen-activated protein kinase kinase 3 isoform B
DE   variant, clone: FCC119G12.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1212
RA   Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.;
RT   ;
RL   Submitted (22-APR-2005) to the INSDC.
RL   Akiko Tanaka, RIKEN Yokohama Institute, Protein Research Group; 1-7-22
RL   Suehiro, Tsurumi, Yokohama, Kanagawa, 230-0045, Japan
RL   (E-mail:aktanaka@riken.jp, URL:http://protein.gsc.riken.jp/,
RL   Tel:81-45-503-9452, Fax:81-45-503-9450)
XX
RN   [2]
RX   DOI; 10.1016/0378-1119(94)90802-8.
RX   PUBMED; 8125298.
RA   Maruyama K., Sugano S.;
RT   "Oligo-capping: a simple method to replace the cap structure of eukaryotic
RT   mRNAs with oligoribonucleotides";
RL   Gene 138(1-2):171-174(1994).
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(97)00411-3.
RX   PUBMED; 9373149.
RA   Suzuki Y., Yoshitomo K., Maruyama K., Suyama A., Sugano S.;
RT   "Construction and characterization of a full length-enriched and a
RT   5'-end-enriched cDNA library";
RL   Gene 200(1-2):149-156(1997).
XX
DR   MD5; a8e24b64fd466cb27f69c16548eedc23.
XX
CC   This work was supported in part by the National Project on Protein
CC   Structural and Functional Analysis, Ministry of Education,
CC   Culture, Sports, Science and Technology of Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1212
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="IMS_HEP"
FT                   /clone="FCC119G12"
FT                   /cell_line="HepG2"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="this clone is also named as hst001000683"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <141..1184
FT                   /codon_start=1
FT                   /product="mitogen-activated protein kinase kinase 3 isoform
FT                   B variant"
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q53EZ9"
FT                   /db_xref="H-InvDB:HIT000331270.11"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q53EZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD97210.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSSTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVK
FT                   EILGEDS"
XX
SQ   Sequence 1212 BP; 266 A; 376 C; 349 G; 221 T; 0 other;
     cgccgccgcc gccgccgccg ccgccgctgc tcctccgcct ggcctgggcc gtctgcccgc        60
     agccatgagc gtgctcggcc ccggtggagc ccgcagtcct ctagattagt ctccaccgcc       120
     gtccaggacc cacttgcagc atggagtcgc ccgcctcgag ccagcccgcc agcatgcccc       180
     agtccaaagg aaaatccaag aggaagaagg atctacggat atcctgcatg tccaagccac       240
     ccgcacccaa ccccacaccc ccccggaacc tggactcccg gaccttcatc accattggag       300
     acagaaactt tgaggtggag gctgatgact tggtgaccat ctcagaactg ggccgtggag       360
     cctatggggt ggtagagaag gtgcggcacg cccagagcag caccatcatg gccgtgaagc       420
     ggatccgggc caccgtgaac tcacaggagc agaagcggct gctcatggac ctggacatca       480
     acatgcgcac ggtcgactgt ttctacactg tcaccttcta cggggcacta ttcagagagg       540
     gagacgtgtg gatctgcatg gagctcatgg acacatcctt ggacaagttc taccggaagg       600
     tgctggataa aaacatgaca attccagagg acatccttgg ggagattgct gtgtctatcg       660
     tgcgggccct ggagcatctg cacagcaagc tgtcggtgat ccacagagat gtgaagccct       720
     ccaatgtcct tatcaacaag gagggccatg tgaagatgtg tgactttggc atcagtggct       780
     acttggtgga ctctgtggcc aagacgatgg atgccggctg caagccctac atggcccctg       840
     agaggatcaa cccagagctg aaccagaagg gctacaatgt caagtccgac gtctggagcc       900
     tgggcatcac catgattgag atggccatcc tgcggttccc ttacgagtcc tgggggaccc       960
     cgttccagca gctgaaacag gtggtggagg agccgtcccc ccagctccca gccgaccgtt      1020
     tctcccccga gtttgtggac ttcactgctc agtgcctgag gaagaacccc gcagagcgta      1080
     tgagctacct ggagctgatg gagcacccct tcttcacctt gcacaaaacc aagaagacgg      1140
     acattgctgc cttcgtgaag gagatcctgg gagaagactc ataggggctg ggcctcggac      1200
     cccactccgg cc                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page