(data stored in ACNUC16935 zone)

EMBL: AK226406

ID   AK226406; SV 1; linear; mRNA; STD; PLN; 932 BP.
XX
AC   AK226406;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   27-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone:
DE   RAFL06-07-F24.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-932
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 13ff054b3b19e2df24890c52e61423c7.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..932
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL06-07-F24"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        68..757
FT                   /codon_start=1
FT                   /gene="At4g05050"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8H0Y0"
FT                   /protein_id="BAE98552.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
XX
SQ   Sequence 932 BP; 254 A; 224 C; 210 G; 244 T; 0 other;
     gacaattcag attccaattt tctcaaactc taaaatcaat ctctcaaatc tctcaaccgt        60
     gatcaagatg cagatcttcg ttaagactct caccggaaag actatcaccc tcgaggtgga       120
     aagctctgac accatcgaca acgttaaggc caagatccag gataaggaag gtattcctcc       180
     ggatcagcag aggcttatct tcgccggaaa gcagttggag gatggccgca cgttggcgga       240
     ttacaatatc cagaaggaat ccaccctcca cttggttctc aggctccgtg gtggtatgca       300
     gattttcgtt aaaaccctaa cgggaaagac gattactctt gaggtggaga gctctgacac       360
     cattgacaac gtcaaggcca agatccaaga taaggagggt attcctccgg accagcagag       420
     gttgatcttc gccggaaagc aacttgagga cggcagaact ttggcggatt acaacatcca       480
     gaaggagtct acgcttcatt tggtcttgcg tctgcgtgga ggtatgcaga tcttcgtaaa       540
     gactttgacc ggaaagacca tcactcttga agttgagagc tccgacacca ttgataacgt       600
     gaaggctaag atccaggaca aggaaggcat tcctccggac cagcagcgtc tcatcttcgc       660
     tggaaagcag cttgaggatg gacgtacttt ggccgactac aacatccaga aggagtctac       720
     tcttcacttg gtcctccgtc tccgtggtgg tttctaaacc ttgtctctct ctcttatggt       780
     tactgaacca agttcatgta tcgtttcatc tagtactttg gtggtttatg ttttggggcc       840
     atgtacagcc tctgataaat aattgatcga ctatgtttcc gtttctttca tctctctttt       900
     ctttcaaaca acaaatcgaa ccaaaaaaaa aa                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page