(data stored in SCRATCH zone)

EMBL: AK227159

ID   AK227159; SV 1; linear; mRNA; STD; PLN; 1749 BP.
XX
AC   AK227159;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   27-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA for anthranilate N-benzoyltransferase - like
DE   protein, complete cds, clone: RAFL09-86-O17.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1749
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 8d1a0b00833b40189ccb12f1cc31e5ca.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1749
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-86-O17"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        81..1508
FT                   /codon_start=1
FT                   /gene="At5g01210"
FT                   /product="anthranilate N-benzoyltransferase-like protein"
FT                   /db_xref="GOA:Q9LFB5"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB5"
FT                   /protein_id="BAE99201.1"
FT                   /translation="MPSCSVTEISKCIVYPEKKSTVSDLRLSVSDLPMLSCHYIQKGVL
FT                   LTSPPPSFSFDDLVSSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASA
FT                   KHVKLSDVLLPGEDVPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHS
FT                   VTDGTSFWHFFNTFADVTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPL
FT                   RERIFHFSREAITKLKQRTNNRVNGIETAVNDGRKCNGEINGKITTVLDSFLNNKKSYD
FT                   RTAEISSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSI
FT                   PTLASAGDLLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITM
FT                   GSSPRFPMYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGI
FT                   ENDAEFMQYVSEVTYDC"
XX
SQ   Sequence 1749 BP; 442 A; 444 C; 398 G; 465 T; 0 other;
     gactcatcac caatacgggc aagttaaacc cataactccc aaaatccata tcctctttaa        60
     aacatttttg tccaaataaa atgccttctt gttcggtaac tgaaatttca aaatgtatcg       120
     tctatccgga gaagaagtcc accgtctccg atctccgtct ctccgtctcc gacctcccta       180
     tgctctcatg tcattacatt caaaaaggcg tcctcctcac cagccctcct ccttccttct       240
     ccttcgacga ccttgtctcc tctctccgcc gttctctctc ctccactctt tccctcttcc       300
     ctgctttagc cggccgtttc tccaccactc ccgccggtca catttccatt gtctgcaacg       360
     acgccggagt tgatttcgtc gccgcttccg ctaaacacgt caaactctct gatgttctct       420
     taccaggtga agacgttcct ctgcttttcc gtgagttttt cgtcttcgag cgtctcgtta       480
     gttacaacgg tcatcataag cctctcgccg ccgttcaagt gacggagctc cacgacggtg       540
     tcttcatcgg atgtaccgtg aatcattccg ttactgacgg aacttccttc tggcacttct       600
     tcaacacctt tgctgacgtc actagcggtg cttgtaagat caaacacctt ccagatttct       660
     cccgccacac cgtcttcgat tctccggtcg ttcttccagt ccctcccggt ggtccacgtg       720
     tcactttcga cgccgaccaa cctctacggg agagaatttt tcatttcagc agagaggcga       780
     ttaccaaact gaaacagagg acgaataaca gagttaacgg aattgagact gccgttaacg       840
     atggaaggaa atgtaacgga gagattaacg gaaaaataac aaccgttttg gatagttttt       900
     tgaataataa gaagagttat gatcggacgg ctgagatttc atcgttccaa tctctcagcg       960
     ctcagctatg gcgatccgtt acacgagcga ggaatctcga tccgagcaag acgacgacgt      1020
     ttcgaatggc ggttaattgc cggcaccggc ttgagccgaa gatggatccg tactacttcg      1080
     gaaacgcgat acagagcata ccgacgttgg cgtctgcggg agatctgcta agcaaagatc      1140
     tcaggtggtc cgccgaacag ttacacagga acgtggtggc gcacgacgac gcgacggtcc      1200
     gccgtggaat cgccgcttgg gaaagcgatc cgaggctgtt tcctctcgga aatccagatg      1260
     gagcttcgat cacgatgggg agctcgccga gattcccaat gtacgacaat gatttcggat      1320
     ggggaaaacc gttagctgtg agaagcggcg gagcgaataa attcgacggg aagatctcgg      1380
     cgtttcccgg tagagaagga aacggaagcg tggatctgga agtagttctg gcgccggaga      1440
     ctatgactgg gattgagaac gatgctgagt ttatgcaata cgtatcagaa gtcacttacg      1500
     attgttgaaa acgacgtagt ttctgataca gaggaaaaaa aagcaaatat ctaaagtgat      1560
     agaggaactt aatggcatgg cactttggac ggttgagatt tatctataaa gtttttagat      1620
     atttcgatct gagagttgtg aagcgaacga cgtcttatga gtcaatctac tggtcttaat      1680
     gtgacagtgt attattaatg tacaaaatcc cgtctttttc aagtttttct ttctaaatta      1740
     agaaaaaaa                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page