(data stored in ACNUC13479 zone)

EMBL: AK228009

ID   AK228009; SV 1; linear; mRNA; STD; PLN; 1102 BP.
XX
AC   AK228009;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Arabidopsis thaliana mRNA for putative signal recognition particle receptor
DE   beta subunit, complete cds, clone: RAFL14-53-H19.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1102
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 23d8c60de28ad7a05d5e5e766fdc83ce.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1102
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL14-53-H19"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        110..892
FT                   /codon_start=1
FT                   /gene="At2g18770"
FT                   /product="putative signal recognition particle receptor
FT                   beta subunit"
FT                   /db_xref="GOA:Q0WSC4"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WSC4"
FT                   /protein_id="BAE99974.1"
FT                   /translation="MDNLEDLKIVAEQWSKQGLEFVQKIPPPQLYTAIGVLLLATIWLL
FT                   SIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTK
FT                   KGKVKPIHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNA
FT                   SVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIE
FT                   GEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVKP"
FT   misc_difference 440
FT                   /replace="g"
FT                   /note="compared to genomic sequence"
XX
SQ   Sequence 1102 BP; 342 A; 223 C; 225 G; 312 T; 0 other;
     aacaacaaca atttcgccgg cgtcgtcgtc gtcgtctctc catcaccgtc tctgctgcat        60
     tgattcgcag cactgagtcc taaatttcca gtgtaaaaaa aatcagaaaa tggacaactt       120
     ggaagatttg aagattgtgg cagagcagtg gtctaaacaa ggacttgaat ttgttcaaaa       180
     aataccacca cctcagcttt atactgccat tggtgttctc ttattagcta ccatttggct       240
     cttatctatt cgtttgttta gacgtacaaa atccaatact gtactcctct ctgggctaag       300
     tggaagtggc aaaacagttc tcttctatca actacgagat ggatcttccc atcagggtgc       360
     tgtaacgtca atggaaccga acgaaggcac ctttgtgctt cacaatgaaa acaacactaa       420
     gaaaggaaaa gtaaagccta ttcatcttat tgatgttcct ggacactctc ggcttatatc       480
     taagctagaa gaatacttgc ctcgagccgc cgctgttgtg tttgtagtag atgcattgga       540
     gttcctccca aatatccggg cagcttcaga gtacctttac gacattctga ccaatgctag       600
     cgttattaag aataagaccc cggttctgct ttgctgtaac aagacagata aagtaactgc       660
     acacaccaaa gagttcatcc gcaagcagat ggagaaagaa atagataaac ttagggtttc       720
     gaggagcgca atatcaacag ctgatatagc gaatgacttc actcttggga ttgaaggaga       780
     agtgttttcc ttttcgcatt gccataacaa agtcacggtc gctgaggcgt ctggactaac       840
     aggagaaaca gatcaggtac aagagttcat cagagaacac gtaaagccat gaggattgtg       900
     taagcatctc agagaatgta cttaaatgtc ttttcatttg tttgtaaatg aaattataat       960
     ttgagaactt agatgatatt cgttggaagg atttttggat gttgaaaacg tgtttactgc      1020
     atcgactgga tcttttagcg tttcatccaa gcaacctcac tatcaataaa ttgtttacaa      1080
     agacagttta tcaaaaaaaa aa                                               1102
//

If you have problems or comments...

PBIL Back to PBIL home page