(data stored in SCRATCH zone)

EMBL: AK228269

ID   AK228269; SV 1; linear; mRNA; STD; PLN; 649 BP.
XX
AC   AK228269;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   27-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA for putative ribosomal protein, complete cds,
DE   clone: RAFL14-72-E22.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-649
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 761f0e4ed699aa7f935fe0a08647f008.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL14-72-E22"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        74..433
FT                   /codon_start=1
FT                   /gene="At4g26230"
FT                   /product="putative ribosomal protein"
FT                   /db_xref="GOA:Q0WRN2"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WRN2"
FT                   /protein_id="BAF00217.1"
FT                   /translation="MSEKKGRKEEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAE
FT                   KEMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPA
FT                   EGLSGLGTKIIEEED"
XX
SQ   Sequence 649 BP; 212 A; 107 C; 161 G; 169 T; 0 other;
     ctccgtcacc accggctctg tatttcggca tttgtggaga gaagaaggta aagagagaag        60
     atagaaacat aaaatgtcgg agaagaaggg aaggaaagag gaggtggtga ccagagagta       120
     caccatcaac cttcacagac gccttcatag ctgtaccttt aagaagaagg ctccaaaggc       180
     gatcaaggag ataaggaagt ttgctgagaa ggaaatgggg acaaaggatg tgagagtgga       240
     tgttaaattg aacaagcaga tttggagcaa aggtatcaga ggtcctccga ggagaatcag       300
     agtccgagtt gctcgtaaga gaaatgatga tgaagatgca aaggaagagt tcttctctct       360
     tgtcactgtt gctgaaatcc ctgctgaagg actctctggc ctcggcacta agatcattga       420
     agaagaggat taaactatct tatagtaaca acaacatttg atcagatttt tcgagttttg       480
     tttttcgaat ctttattgga gagaacattt atcttcttga atccttaagc cttgaatcat       540
     agtatgcgat tgagacagaa tctcagtctt gtgtcgtaag tagtcttcaa caatccttac       600
     acttgtttcg gtaaagtttg agcatctggt tcgatcatga aaaaaaaaa                   649
//

If you have problems or comments...

PBIL Back to PBIL home page