(data stored in SCRATCH zone)

EMBL: AK228310

ID   AK228310; SV 1; linear; mRNA; STD; PLN; 1694 BP.
XX
AC   AK228310;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   27-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA for arginyl-tRNA synthetase, complete cds, clone:
DE   RAFL14-74-F11.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1694
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; a3b64bef8bc7d575dbe439ee45e66ab5.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1694
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL14-74-F11"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        703..1521
FT                   /codon_start=1
FT                   /gene="At4g26300"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="GOA:Q0WRJ6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WRJ6"
FT                   /protein_id="BAF00253.1"
FT                   /translation="MDCLLVLNFAWPRYRLNEEKAEWIIYVTDVGQQQHFNMFFKAARK
FT                   AGWLPDNDKTYPRVNHVGFGLVLGEDGKRFRTRATDVVRLVDLLDEAKTRSKLALIERG
FT                   KDKEWTPEELDQTAEAVGYGAVKYADLKNNRLTNYTFSFDQMLNDKGNTAVYLLYAHAR
FT                   ICSIIRKSGKDIDELKKTGKLALDHADERALGLHLLRFAETVEEACTNLLPSVLCEYLY
FT                   NLSEHFTRFYSNCQVNGSPEETSRLLLCEATAIVMRKCFHLLGITPVYKI"
XX
SQ   Sequence 1694 BP; 493 A; 327 C; 391 G; 483 T; 0 other;
     aaatgcatgt tggtcatcta agatcaacta tcattggtga cactctagct cgcatgctcg        60
     agtactcaca tgttgaagtt ctacgcagaa accatgttgg tgactgggga acacagtttg       120
     gcatgctaat tgagtacctc tttgagaaat ttcctgatac agatagtgtg accgagacag       180
     caattggaga tcttcaggtg ttttacaagg catcaaaaca taaatttgat ctggacgagg       240
     cctttaagga aaaagcacaa caggctgtgg tccgtctaca gggtggtgat cctgtttacc       300
     gtaaggcttg ggctaagatc tgtgacatca gccgaactga gtttgccaag gtttaccaac       360
     gccttcgagt tgagcttgaa gaaaaggtaa aggagaaagc ttttacaacc ctcatattgc       420
     taaagtaatt gaggaattga atagcaaggg gttggttgaa gaaagtgaag gtgctcgtgt       480
     gattttcctt gaaggcttcg acatcccact catggttgta aagagtgatg gtggttttaa       540
     ctatgcctca acagatctga ctgctctttg gtgggttatc tttacgttag ttatttcatg       600
     aaatccggat tttagtagtg atcttttgaa aatagatctc acatgttatg actttccgtg       660
     tctgtactta ctgaagtttg atctgaactt gcatattgtt caatggattg tctgctggtg       720
     ctaaattttg cctggcccag gtaccggctc aatgaagaga aagctgagtg gatcatatat       780
     gtgaccgatg ttggccagca gcagcacttt aatatgttct tcaaagctgc cagaaaagca       840
     ggttggcttc cagacaatga taaaacttac cctagagtta accatgttgg ttttggtctc       900
     gtccttgggg aagatggcaa gcgatttaga actcgggcaa cagatgtagt ccgcctagtt       960
     gatttgctag atgaggccaa gactcgcagt aaacttgccc ttattgagcg cggtaaggac      1020
     aaagaatgga caccggaaga actggaccaa acagctgagg cagttggata tggtgcggtc      1080
     aagtatgctg acctgaagaa caacagatta acaaattata ctttcagctt tgatcaaatg      1140
     cttaatgaca agggaaatac agccgtttac cttctttacg cccatgctcg gatctgttca      1200
     atcatcagaa agtctggcaa agacatagat gagctgaaaa agacaggaaa attagcattg      1260
     gatcatgcag atgaacgagc actggggctt cacttgcttc gatttgctga gacggtggag      1320
     gaagcttgta ccaacttatt accgagtgtt ctgtgcgagt acctctacaa tttatctgaa      1380
     cactttacca gattctactc caattgtcag gtcaatggtt caccagagga gacaagccgt      1440
     ctcctacttt gtgaagcaac ggccatagtc atgcggaaat gcttccacct tcttggaatc      1500
     actccggttt acaagatttg atcacatcac aagtaaacga cccaaaggaa aatgttttta      1560
     attcgttttg acaatttttc tgcacaatta gtgtaaaagg cgttatttgg ccctaaattc      1620
     tctctgttct catttagctt ggggcaaact tgtatacaaa tgaatacaat gttaaactga      1680
     acccaaaaaa aaaa                                                        1694
//

If you have problems or comments...

PBIL Back to PBIL home page