(data stored in SCRATCH zone)

EMBL: AK228471

ID   AK228471; SV 1; linear; mRNA; STD; PLN; 1471 BP.
XX
AC   AK228471;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Arabidopsis thaliana mRNA for lectin - like protein, complete cds, clone:
DE   RAFL15-07-E01.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1471
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; a74efd26a94f57f1061f7b321cea777f.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1471
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL15-07-E01"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   misc_difference 4
FT                   /replace="a"
FT                   /note="compared to genomic sequence"
FT   CDS_pept        216..1277
FT                   /codon_start=1
FT                   /gene="At5g01090"
FT                   /product="lectin-like protein"
FT                   /db_xref="GOA:Q9LFC7"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC7"
FT                   /protein_id="BAF00398.1"
FT                   /translation="MAVFKTLAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNV
FT                   ALFGDSKLVHGGPSIQLTDSVSRSEGRVIYKKPIRLFQGKERNFSGSFSTSFSFSMSDE
FT                   IGSVLAFIMVPRGLDLRLFGRKGNNSSSGLGFLLKHKVVAVEFGISKRGNHVGILVGRP
FT                   ESGKVRKLSSFGHHFNEEKRLNCWIDYEASSKRIEVRLSLSAALKPVDPFVSYSVDLAK
FT                   LWKDGKFMVGLTSANGNTSKPVYLHSWSFKLRHPSMRIHSQPLDPNDVSKTVKEGEKTV
FT                   EVKGKGKCIWRILGALVLGAVCGTLGAMFALYLWTICGNRQSMAIVPEECADEKADILV
FT                   TKADVVVEEEVKK"
XX
SQ   Sequence 1471 BP; 408 A; 234 C; 347 G; 482 T; 0 other;
     aagtgtgttg tttgagagcg aatcaaggtt cctccaaaga aggaagatga ctttaattct        60
     tatttaattt ccctttctcc ttttgcttca ccaaaatcca cacattcatc aattaaaaaa       120
     caaaccctag attcttgaaa actggaactc attcacgaat cctaaaaaga gagctccttt       180
     ggttttcttg aaacccagat tcttcaagct cagctatggc ggtcttcaaa accctagctt       240
     tcctattcgt tttaagcatc gtgatttacc aatcagtggc tgttacagat gtaaattcat       300
     cgttttcctt taatgggttt gtgaaagctc caagctttga caataatgtt gctctgtttg       360
     gagattcgaa gctcgttcat ggcggtccat cgatacaatt gactgactca gtgagtcgca       420
     gtgaagggcg agttatttac aagaaaccca tcagactgtt ccaaggtaaa gagagaaact       480
     tttccggatc attctcaact agtttctcgt tttcgatgtc tgatgagatt ggtagtgtct       540
     tggcttttat aatggttcca agaggtttgg atcttaggtt gtttggtaga aagggtaata       600
     atagttcctc tggtttaggg ttcttattga aacacaaagt tgttgctgtt gagtttggta       660
     tctccaagag agggaatcat gtagggatct tagttggtcg tcctgaatct ggtaaagtta       720
     gaaagttatc atcttttggt caccatttca atgaagagaa gagattgaat tgttggattg       780
     attatgaggc aagctcaaag agaatagagg ttcgtttgag tctatctgct gccttaaagc       840
     cggtggatcc attcgtgtct tactctgtag acttggctaa gctatggaaa gatgggaagt       900
     ttatggtggg tttaacctct gcaaatggaa acacttcaaa gccggtttat ctccattcgt       960
     ggagctttaa actgagacat ccttcgatga ggattcactc gcagccgctt gatccaaacg      1020
     acgtttccaa gactgttaag gaaggggaga agacggtgga agttaagggg aaaggaaaat      1080
     gtatatggag aatccttggt gcattggttt tgggggcggt ttgtggaaca ttgggagcca      1140
     tgttcgcgtt atacctttgg acaatatgcg gtaataggca gtcaatggcg atagttcccg      1200
     aggaatgtgc tgacgaaaaa gcggatatcc ttgtaacgaa agctgatgtt gttgttgaag      1260
     aagaagtcaa gaagtagtag aaaaagaaaa gtttggtgtg tgtgttttag aatgttgtat      1320
     ttgttgtttg taatgtaaat tcttgtgtcc ttctttattc ttcttctgtt tgtttttttg      1380
     ttagttgcag atttggtgag atgagttttc acatgtagaa gaatcataca atatgtatta      1440
     agttaagatc ctgaaatctt gatcaaaaaa a                                     1471
//

If you have problems or comments...

PBIL Back to PBIL home page