(data stored in ACNUC21429 zone)

EMBL: AK228616

ID   AK228616; SV 1; linear; mRNA; STD; PLN; 1982 BP.
XX
AC   AK228616;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Arabidopsis thaliana mRNA for ubiquitin-like protein, complete cds, clone:
DE   RAFL15-44-C22.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1982
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; 41bdcac047b4f8b677bef72b824afc58.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1982
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL15-44-C22"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        143..1759
FT                   /codon_start=1
FT                   /gene="At2g17190"
FT                   /product="ubiquitin-like protein"
FT                   /db_xref="GOA:Q9SII9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII9"
FT                   /protein_id="BAF00527.1"
FT                   /translation="MGGEADSRQPLTAEGVAVAVNVRCSNGTKFSVTTSLDSTVESFKE
FT                   LIAQNSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTVHMVRGFVPSSPSAPAANAGN
FT                   QTTAPQAVGSNDSSNLGGGESLFPGLGFNPLGGGNAMAGLFGSGLPDLEQAQQQLAQNP
FT                   NMIREMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAA
FT                   RNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSENAGNNTSSNP
FT                   FAALLGNQGVTTQGSDTSNNISAPNAETGTPNANPLPNPWGATAGQTTAPGRTNAGLGG
FT                   LGGLGGLGGLGMLGADSPLGATPDASQLSQILQNPAMSQMMQSVLSNPQYMNQLMSLNP
FT                   QLRSMLDMNPQLREMMQNPDFLRQFSSPEMMQQMMSLQQSLFSQNRNTAGQDPTQTGAA
FT                   TGTANNGGLDLLMNMFGSLGAGGLSGTNQPNVPPEERFATQLQQLQEMGFYDRAENIRA
FT                   LLATNGNVNAAVERLLGSIGQ"
FT   misc_difference 1057
FT                   /replace="g"
FT                   /note="compared to genomic sequence"
XX
SQ   Sequence 1982 BP; 534 A; 446 C; 458 G; 544 T; 0 other;
     ctttcctcaa gaaatcttca gaaccgactt attagagctt cgagtctcct caaatcttct        60
     tctacgattt tttcttctag gtttagagct tttgattctc cgatcaattt cgcgatttgt       120
     tgaactagga tctgaaatta gaatgggtgg tgaagcagat tcgaggcagc cgctgactgc       180
     tgaaggcgta gctgttgccg tgaacgtcag atgctccaat ggcacgaaat ttagtgtgac       240
     gacgagcctc gattccacgg tggagtcttt caaagagtta attgcgcaga acagcgatgt       300
     gccggcaaat cagcagcgtt tgatttacaa gggacgtatc ctcaaagacg atcagactct       360
     cctcagctat ggtttgcagg ctgatcacac cgttcatatg gttcgaggtt ttgtgccttc       420
     ttctccttct gctcccgctg caaatgctgg aaaccaaacc actgctcctc aagcggttgg       480
     ttcaaatgat agctcaaacc tcggaggagg tgaatctttg ttccctggcc ttggatttaa       540
     tcctttgggt ggtggaaatg ctatggctgg attatttgga tctggtcttc ctgatcttga       600
     gcaggcacag caacaactag ctcagaaccc taacatgatt agagagatga tgaatactcc       660
     agccatccag aatcttatga acaacccaga atttatgagg agtatgatta tgaataaccc       720
     tcaaatgcgt gagcttgtag atcgcaatcc tgagcttggt catgtgctca atgacccaag       780
     catccttcgt caaactctag aagcggcgag aaacccagag cttatgcgtg aaatgatgag       840
     aaatactgat agggctatga gtaatattga gtctatgcct gagggattta acatgcttag       900
     gcgtatgtat gaaaatgtcc aggaaccgtt aatgaatgct accactatgt ccgagaatgc       960
     tggaaacaat acgagctcta atccatttgc tgctcttctg ggaaaccagg gggttactac      1020
     acaaggaagc gatacttcta ataatatttc ggcaccaaat gctgaaacgg gtacacctaa      1080
     tgcaaatcca cttcctaatc cttggggtgc cacggctggc cagacaactg cccctggaag      1140
     gacaaatgct ggacttggtg gtcttggtgg gcttggaggc cttggtggac tcggtatgct      1200
     gggagcggac tcacctcttg gtgcgactcc agatgcttct caattgagcc aaatactgca      1260
     aaaccccgct atgtcgcaga tgatgcaaag cgtactttcc aatccacagt acatgaatca      1320
     gcttatgagt cttaacccac aactccgaag catgctagat atgaatcctc agttgaggga      1380
     aatgatgcag aaccctgatt tccttcgcca gtttagctct cccgagatga tgcagcaaat      1440
     gatgtctcta caacaatcac ttttctctca gaataggaac acggctggcc aggatcctac      1500
     gcaaactggt gctgcgacag ggacagccaa taacggagga ctagatttat tgatgaatat      1560
     gtttggcagc cttggtgctg gcggcctaag tggcacaaac caacccaatg ttcctcctga      1620
     agagcgattt gcgactcagt tgcaacagtt gcaagaaatg ggattctacg acagagcaga      1680
     gaacataagg gctttgcttg caaccaatgg taacgttaac gctgctgtag aacgactctt      1740
     ggggagtatt ggccagtaac atacaggatc gcgaacttgt ggatagaaaa gccgctcatc      1800
     gatacactat ttgttttcaa tggtcatctt ctttcctctt tacccaatcc ccacaacctt      1860
     ttttacatac tttgggtcgt ctgttatctt tcagattcta tttgaagttg ttacctcgta      1920
     catctgtaga agttgatttc gaaatgtgga atggttacat ttacgttttc ttaaaaaaaa      1980
     aa                                                                     1982
//

If you have problems or comments...

PBIL Back to PBIL home page