(data stored in SCRATCH zone)

EMBL: AK229418

ID   AK229418; SV 1; linear; mRNA; STD; PLN; 1488 BP.
XX
AC   AK229418;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   27-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone:
DE   RAFL16-68-O16.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1488
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Motoaki Seki, RIKEN Plant Science Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
RL   Yokohama, Kanagawa 230-0045, Japan (E-mail:mseki@psc.riken.jp,
RL   URL:http://rarge.gsc.riken.jp/, Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Morosawa T.,
RA   Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K.,
RA   Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K.,
RA   Akiyama K., Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
RA   Hayashizaki Y., Shinozaki K.;
RT   "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs";
RL   Unpublished.
XX
DR   MD5; dc18a8f55c5f713ac89ce51804abd601.
XX
CC   An Arabidopsis full-length cDNA library was constructed essentially
CC   as reported previously (Seki et al. (1998) Plant J. 15:707-720;
CC   Seki et al. (2002) Science 296:141-145).
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1488
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL16-68-O16"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        178..1401
FT                   /codon_start=1
FT                   /gene="At5g01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /protein_id="BAF01279.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
XX
SQ   Sequence 1488 BP; 480 A; 277 C; 307 G; 424 T; 0 other;
     gagttcttta acttttcaaa actagacagc ccccaaagac aagaacgtgg tcaaaacaag        60
     ttaaacaaga aataaaacag acacagagaa actcaaaagt ggtttctttc ttatcaatct       120
     aaatctcctt ttcttttctg gtttccaact tcagaacatt tcagttctgt gtttattatg       180
     gatcgtcatg atatagaaaa gagattcacg gtggtgattg ataacagacg actaaaccaa       240
     tcaggatcat catcactttt caccgccttc gctatcagct ttgtaactct gatcgtggtt       300
     accacgttta ctctaatttc taatttctcg atgcaaccgc atagagattt ctcaggagtg       360
     aagatagaga tcaagagagt gattccacac ttacctctga gttctgagag agaaggtgaa       420
     agaagtgatc tgctcaaaca acagacacaa gtaaacgaga agctccaagt tatcgaagtt       480
     ttcagtggag ataacttgtc tgacaagttt caaaagaggg taaatgagtt tgtcggtgat       540
     ggatgcgaag tcaacttcgt catgacatgg atatcaccag cagatttctt tggcaataga       600
     gaggttttag ctattgaaag tgtctttaag tctcatccgt atggttgctt gatgatctta       660
     tccgcaacca tggattctcc tcaaggttat gcaactttga agccgtttat tgatcgtggt       720
     tacaaagttc ttgcagtcac accagatttg ccttttctgc tcaaaggaac cgcgggagag       780
     ttgtggctcg acgaaataaa gagcggtaaa agagatcccg gaaagatttc tttagctcag       840
     aatctctcaa atctcatgag gcttgcttac ttgtacaaat atggaggtgt gtacttagac       900
     acagacatga ttgttctaaa aagcttcaaa ggtctgagaa acgtgattgg tgcacaaaca       960
     cttgatcctt catcaacgaa ttggacaaga ctaaacaacg cggtactaat attcgacaag      1020
     aaccatcctc tgttactcaa attcatggaa gagttcgcta aaactttcaa cggaaacata      1080
     tggggataca acggaccata ccttgtttca cgagtggcta gagctgtaga aggatcaagt      1140
     ggctataact tcaccgtcat gcgaccatct gtgttctatt cggtaaactg gctcgagatt      1200
     aagaagttgt tcaaagtgcc taaaacagag aaagattcga aatgggtcaa aaccaagctt      1260
     cttcatatgc agaggaatgg ttatggtttg catctgtgga ataagtttag caggaaatac      1320
     gaaattgaac aaggaagtgc catgtggaaa ctggtttcag agcattgcat aatctgtgaa      1380
     attagttctg tatcatcata gtctattgtt tgaatttgtt ccattaatca cacacactgt      1440
     agataacttt gttgtaaata agaagcaaaa ccttcaggaa aaaaaaaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page