(data stored in ACNUC5340 zone)

EMBL: AK242196

ID   AK242196; SV 1; linear; mRNA; STD; PLN; 452 BP.
XX
AC   AK242196;
XX
DT   11-OCT-2006 (Rel. 89, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA, clone: J075165I06, full insert sequence.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-452
RA   Kikuchi S., Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P.,
RA   Doi K., Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W.,
RA   Hayashida K., Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F.,
RA   Hotta I., Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J.,
RA   Ishii Y., Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H.,
RA   Kawagashira N., Kawai J., Kawamata M., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakahama Y., Nakamura M., Namiki T.,
RA   Narikawa R., Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E.,
RA   Ohno M., Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R.,
RA   Saitoh H., Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K.,
RA   Satoh K., Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y.,
RA   Sugano S., Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y.,
RA   Tagawa A., Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T.,
RA   Tsunoda Y., Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M.,
RA   Yasunishi A., Yazaki J., Yokomizo S., Yoshimura A., Eguchi K., Kanamori H.,
RA   Yamagata H., Kamiya K., Kurita K., Kikuta A., Bito T.;
RT   ;
RL   Submitted (10-OCT-2006) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Division of Genome and Biodiversity Research; 2-1-2 Kannondai, Tsukuba,
RL   Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S.;
RT   "Oryza sativa full length cDNA";
RL   Unpublished.
XX
DR   MD5; 53e431b29bd21f229e2f16533494437e.
XX
CC   This clone is one of the 2.6K full-length cDNA clones from
CC   japonica rice.
CC   URL:http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.,
CC   Yamamoto,M. and Nakahama,Y.
CC   NIAS STAFF Institute Sequence group: Eguchi,K., Kanamori,H.,
CC   Yamagata,H., Kamiya,K., Kurita,K., Kikuta,A. and Bito,T.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..452
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /dev_stage="1 week after flowering"
FT                   /clone="J075165I06"
FT                   /tissue_type="ear"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        73..372
FT                   /note="(Rice Genome Annotation Project) expressed protein"
FT                   /note="mapping to R11-TIGRv4S1-000474R (Chr.11: short
FT                   arm=14794604, long arm=14795145, direction=reverse) for
FT                   TIGR Pseudomol ver4"
FT                   /db_xref="UniProtKB/TrEMBL:Q53JQ3"
FT                   /protein_id="BAH01219.1"
FT                   /translation="MGKCLRPTHQEVMLFCLVLLLCSAIPAQTRDIGQTTNEIQKDMST
FT                   GVKNKNSFGELYYKPDHCVQTPGGFYCCALDQLCYPTIGLCIPECTSSKVRRGS"
XX
SQ   Sequence 452 BP; 136 A; 96 C; 98 G; 122 T; 0 other;
     caggcagact catcctcatt caactagtta gttacagcaa gaaaagtaaa gcatagtaag        60
     tcatctttcg caatggggaa atgtttaagg ccgacccacc aagaagtcat gttgttttgc       120
     ttggttcttc tgctgtgctc tgccattcct gcacaaacaa gagatatagg tcaaaccaca       180
     aatgagatcc aaaaagatat gtcgaccggt gtgaaaaaca agaatagctt tggagaactt       240
     tattataaac ctgatcactg tgttcaaacc cccggtgggt tctattgctg tgcactggac       300
     cagctgtgct atccaactat tgggctgtgc ataccagaat gcacatcatc aaaggtgcgc       360
     agaggatcat gatgagcaag tgattaatta cgaataatca tgtactccac ccagcagttg       420
     ggattagtta tggatgcctg atttctatgt cc                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page