(data stored in ACNUC7421 zone)

EMBL: AK242840

ID   AK242840; SV 1; linear; mRNA; STD; PLN; 1053 BP.
XX
AC   AK242840;
XX
DT   11-OCT-2006 (Rel. 89, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA, clone: J090070E16, full insert sequence.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-1053
RA   Kikuchi S., Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P.,
RA   Doi K., Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W.,
RA   Hayashida K., Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F.,
RA   Hotta I., Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J.,
RA   Ishii Y., Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H.,
RA   Kawagashira N., Kawai J., Kawamata M., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakahama Y., Nakamura M., Namiki T.,
RA   Narikawa R., Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E.,
RA   Ohno M., Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R.,
RA   Saitoh H., Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K.,
RA   Satoh K., Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y.,
RA   Sugano S., Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y.,
RA   Tagawa A., Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T.,
RA   Tsunoda Y., Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M.,
RA   Yasunishi A., Yazaki J., Yokomizo S., Yoshimura A., Eguchi K., Kanamori H.,
RA   Yamagata H., Kamiya K., Kurita K., Kikuta A., Bito T.;
RT   ;
RL   Submitted (10-OCT-2006) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Division of Genome and Biodiversity Research; 2-1-2 Kannondai, Tsukuba,
RL   Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S.;
RT   "Oryza sativa full length cDNA";
RL   Unpublished.
XX
DR   MD5; 8d658d0f81739cae2dc01988641b05f1.
XX
CC   This clone is one of the 2.6K full-length cDNA clones from
CC   japonica rice.
CC   URL:http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.,
CC   Yamamoto,M. and Nakahama,Y.
CC   NIAS STAFF Institute Sequence group: Eguchi,K., Kanamori,H.,
CC   Yamagata,H., Kamiya,K., Kurita,K., Kikuta,A. and Bito,T.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1053
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /dev_stage="5 days after pollination"
FT                   /clone="J090070E16"
FT                   /tissue_type="pistil"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        63..947
FT                   /note="(Rice Genome Annotation Project)
FT                   methylglutaconyl-CoA hydratase, mitochondrial precursor,
FT                   putative, expressed"
FT                   /note="mapping to R02-TIGRv4S1-001082F (Chr.2: short
FT                   arm=26376062, long arm=26379812, direction=forward) for
FT                   TIGR Pseudomol ver4"
FT                   /db_xref="GOA:B7F9R1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7F9R1"
FT                   /protein_id="BAH01359.1"
FT                   /translation="MRRLLAASGRCAPATRTHHGLFARAIQILAPPDPVSLHKLSAPDC
FT                   EIVELRLERPEVKNAINWEAMRLLRGVVEKVEADDTVKVVLVTSSVPGVFCAGADLKER
FT                   KLMSSSGVREYANSLRSTFSSFEALSIPTIAVIEGAALGGGLELALSCDLRICGENATL
FT                   GLPETGLAIIPGAGGTQRLPRIVGRSRAKEMIFTGRRCNATEAVMMGLANYCVPAGEAH
FT                   EKALELAREIAQKGPLGIRMAKKAIDQGMQAADMPSALAVEGECYEQLLHTEDRLEGLA
FT                   AFAERRKPVYSGK"
XX
SQ   Sequence 1053 BP; 235 A; 276 C; 307 G; 235 T; 0 other;
     gatccgcatg agcagcgcgc atcgccgtgt tcttcacttc ttcccatccg tccacttcca        60
     caatgcggcg cctcctcgcc gcctccggcc gctgcgctcc ggcgacccgc acccaccatg       120
     ggctcttcgc gcgcgccatc cagatcttgg cgccgccgga tcccgtcagt ctccacaagc       180
     tctcggcacc cgactgcgaa atcgtagagc tgaggctgga gcgtccggag gtcaagaacg       240
     ccatcaactg ggaagccatg aggctgctgc ggggtgtggt cgagaaggtt gaggctgacg       300
     acaccgtgaa ggtcgtcctg gtcacgagct ccgtgcctgg agttttctgc gcaggcgccg       360
     atctcaagga acggaaacta atgagctctt ctggagttag agaatatgca aattccttga       420
     gatctacatt ctcatccttt gaggcactat ctattccaac aattgctgtc attgaaggag       480
     ctgctttggg tggtgggcta gaactggcac tttcatgcga cctgcgtata tgtggagaaa       540
     atgcaactct tggactgcca gagacaggac ttgctatcat tcctggagct gggggcacac       600
     agcgtcttcc taggattgtt ggaaggtcca gagcgaagga gatgatattc accggccgta       660
     gatgtaatgc aactgaagct gtaatgatgg gactcgcaaa ctactgcgtt ccagcagggg       720
     aggctcatga aaaagccctt gaacttgccc gcgagatagc ccagaaaggg cctctgggga       780
     taagaatggc caagaaggcc attgatcaag ggatgcaggc agcagacatg ccgtccgcgt       840
     tggccgtcga aggggagtgc tacgagcagc tgctgcacac ggaggatcgc cttgagggcc       900
     tagccgcatt cgccgagagg aggaaacctg tatactcagg aaagtagttt atctgtgtat       960
     acagtatact gccatttggt gtcgtggtga tcattttcgc ttgcccgttc ccggtgactt      1020
     tagtcgagag taaataaaga agtttgtgtc gat                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page