(data stored in ACNUC22857 zone)

EMBL: AK289528

ID   AK289528; SV 1; linear; mRNA; STD; HUM; 3204 BP.
XX
AC   AK289528;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ78733 complete cds, highly similar to Homo sapiens
DE   adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript
DE   variant 1, mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3204
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 3932e7ca13744cfcdd7ec8f498dc2084.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3204
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRACE3"
FT                   /clone="BRACE3017065"
FT                   /tissue_type="cerebellum"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        131..2986
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens adaptor-related
FT                   protein complex 2, beta 1 subunit (AP2B1), transcript
FT                   variant 1, mRNA"
FT                   /db_xref="GOA:A8K0G3"
FT                   /db_xref="H-InvDB:HIT000422325.6"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:A8K0G3"
FT                   /protein_id="BAF82217.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYME
FT                   MNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQSQIKEC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 3204 BP; 897 A; 764 C; 741 G; 802 T; 0 other;
     agacctagaa aagaatcgtg acgggcagga aaccattaca ccaccacctg ggctgtgctc        60
     tccggctccc gccgccaccc ccgccctcgc cttcgcctcc gcctccggtg cacattaaag       120
     atccaaagtc atgactgact ccaagtattt cacaaccaat aaaaaaggag aaatatttga       180
     actaaaagct gaactcaaca atgaaaagaa agaaaagaga aaggaggctg tgaagaaagt       240
     gattgctgct atgaccgtgg ggaaggatgt tagttctctc tttccagacg tagtgaactg       300
     tatgcagact gacaatctgg aactaaagaa gcttgtgtat ctctacttga tgaactacgc       360
     caagagtcag ccagacatgg ccatcatggc tgtaaacagc tttgtgaagg actgtgaaga       420
     tcctaatcct ttgattcgag ccttggcagt cagaaccatg gggtgcatcc gggtagacaa       480
     aattacagaa tatctctgtg agccgctccg caagtgcttg aaggatgagg atccctatgt       540
     tcggaaaaca gcagcagtct gcgtggcaaa actccatgat atcaatgccc aaatggtgga       600
     agatcaggga tttctggatt ctctacggga tctcatagca gattcaaatc caatggtggt       660
     ggctaatgcc gtagcggcat tatctgaaat cagtgagtct cacccaaaca gcaacttact       720
     tgatctgaac ccacagaaca ttaataagct gctgacagcc ctgaatgaat gcactgaatg       780
     gggccagatt ttcatcctgg actgcctgtc taattacaac cctaaagatg atcgggaggc       840
     tcagagcatc tgtgagcggg taactccccg gctatcccat gccaactcag cagtggtgct       900
     ttcagcggta aaagtcctaa tgaagtttct agaattgtta cctaaggatt ctgactacta       960
     caatatgctg ctgaagaagt tagcccctcc acttgtcact ttgctgtctg gggagccaga      1020
     agtgcagtat gtcgccctga ggaacatcaa cttaattgtc cagaaaaggc ctgaaatctt      1080
     gaagcaggaa atcaaagtct tctttgtgaa gtacaatgat cccatctatg ttaaactaga      1140
     gaagttggac atcatgattc gtttggcatc tcaagccaac attgctcagg ttctggcaga      1200
     actgaaagaa tatgctacag aggtggatgt tgactttgtt cgaaaagctg tgcgggccat      1260
     tggacggtgt gccatcaagg tggagcaatc tgcagagcgc tgtgtaagca cattgcttga      1320
     tctaatccag accaaagtga attatgtggt ccaagaagca attgttgtca tcagggacat      1380
     cttccgcaaa taccccaaca agtatgaaag tatcatcgcc actctgtgtg agaacttaga      1440
     ctcgctggat gagccagatg ctcgagcagc tatgatttgg attgtgggag aatatgctga      1500
     aagaattgac aatgcagatg agttactaga aagcttcctg gagggttttc acgatgaaag      1560
     cacccaggtg cagctcactc tgcttactgc catagtgaag ctgtttctca agaaaccatc      1620
     agaaacacag gagctagtcc agcaggtctt gagtttggca acacaggatt ctgataatcc      1680
     tgaccttcga gaccggggct atatttattg gcgccttctc tcaactgacc ctgttacagc      1740
     taaagaagta gtcttgtctg agaagccact gatctctgag gagacggacc ttattgagcc      1800
     aactctgctg gatgagctaa tctgccacat tggttctttg gcctctgtgt atcataagcc      1860
     tcccaatgct tttgtggaag gaagtcatgg aattcatcgt aaacacttgc caattcatca      1920
     tgggagcact gatgcaggtg acagccctgt tggcactacc actgcaacga acctggaaca      1980
     gcctcaggtt atcccctctc aaggtgatct tctaggggat cttttaaacc ttgacctcgg      2040
     tcccccagtc aatgtgccac aggtgtcctc catgcagatg ggagcagtgg atctcctagg      2100
     aggaggacta gatagtctgc ttggcagtga ccttggcggg ggcattggag gaagtccggc      2160
     agtgggacaa tccttcatcc catcatcggt gcctgcaacc tttgctcctt cacctacacc      2220
     tgctgtggtc agcagtggac tgaatgacct gtttgaactc tccacaggga taggcatggc      2280
     acctggtgga tatgtggctc ctaaggctgt ctggctacct gcagtaaagg ctaaaggctt      2340
     ggagatttcc ggaacattta ctcaccgcca agggcacatc tatatggaaa tgaacttcac      2400
     caataaagct ctgcagcaca tgacagattt tgcaatccag tttaacaaaa atagctttgg      2460
     tgtcatcccc agcactcctc tggccatcca tacaccactg atgccaaacc agagcattga      2520
     tgtctccctg cctctcaata ccttgggccc agtcatgaag atggaacctc tgaataacct      2580
     ccaggtggct gtgaaaaaca atatcgatgt cttctacttc agctgcctca tcccactcaa      2640
     tgtgcttttt gtagaagatg gcaaaatgga gcgccaggtc ttccttgcaa catggaagga      2700
     tattcccaat gaaaatgaac ttcagtctca gattaaggaa tgtcatttaa atgctgacac      2760
     tgtttccagc aagttgcaaa acaacaatgt ttatactatt gccaagagga atgtggaagg      2820
     gcaggacatg ctgtaccaat ccctgaagct cactaatggc atttggattt tggccgaact      2880
     acgtatccag ccaggaaacc ccaattacac gctgtcactg aagtgtagag ctcctgaagt      2940
     ctctcaatac atctatcagg tctacgacag cattttgaaa aactaacaag actggtccag      3000
     tacccttcaa ccatgctgtg atcggtgcaa gtcaagaact cttaactgga agaaattgta      3060
     ttgctgcgta gaatctgaac acactgaggc cacctagcaa ggtagtaact agtctaacct      3120
     gtgctaacat tagggcacaa cctgttggat agttttagct tcctgtgaac atttgtaacc      3180
     actgcttcag tcacctccca cctc                                             3204
//

If you have problems or comments...

PBIL Back to PBIL home page