(data stored in ACNUC7371 zone)

EMBL: AK289946

ID   AK289946; SV 1; linear; mRNA; STD; HUM; 1531 BP.
XX
AC   AK289946;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ76001 complete cds, highly similar to Homo sapiens
DE   lipoma HMGIC fusion partner-like 1 (LHFPL1), mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1531
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; c66fa99a33611e12ef44dfceac13e13e.
DR   Ensembl-Gn; ENSG00000182508; homo_sapiens.
DR   Ensembl-Tr; ENST00000371968; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1531
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRHIP2"
FT                   /clone="BRHIP2021367"
FT                   /tissue_type="hippocampus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        367..1029
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens lipoma HMGIC fusion
FT                   partner-like 1 (LHFPL1), mRNA"
FT                   /db_xref="GOA:Q86WI0"
FT                   /db_xref="H-InvDB:HIT000422743.6"
FT                   /db_xref="HGNC:HGNC:6587"
FT                   /db_xref="InterPro:IPR019372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q86WI0"
FT                   /protein_id="BAF82635.1"
FT                   /translation="MRSSLTMVGTLWAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSFS
FT                   TFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVL
FT                   GCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPLGWNSPEIMQTCGNVSNQFQLGTC
FT                   RLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVILVESIMRNTNSYAMELDHCLKP"
XX
SQ   Sequence 1531 BP; 352 A; 368 C; 406 G; 405 T; 0 other;
     ggacacacac acgcgcgtgc gcgcgcgcgc gcacacacac acacacacac acacagagct        60
     gctttgtccg ctgtgaggtt ggaggtttgg ggactctgtg cccactaagc tactttctat       120
     ttcaagtgcc tgtatgtctg aggctgggtt tgaagcctcc agcgtgtttg gagttaatcc       180
     ccattaggtt ggactccgcc cctttctccc aaaggtaaag caaggttttc aggcatcact       240
     gcaaagggca gctagtattc ccatccttgt ctaacaagct gtaaggagaa gttgtttctg       300
     agatctgagc ctgaagggag ggaacaagtc agtcagcctt cgtggtcaga agagaaacct       360
     gtgaccatga ggagcagcct gaccatggtg ggaaccctct gggccttcct gtcccttgtt       420
     actgctgtga ccagttctac cagttacttc ctaccttact ggctctttgg atcccagatg       480
     gggaagccag tgtcattcag cacattccgg aggtgcaact accctgtgcg gggagaggga       540
     cacagtctga tcatggtgga agaatgtggg cgctatgcca gcttcaatgc catcccaagc       600
     ctggcctggc agatgtgcac agtggtgaca ggtgccggct gtgctctgct gctcctggtg       660
     gcactagctg ctgtcctggg ttgctgcatg gaggagctca tctccagaat gatgggacgt       720
     tgcatgggag cagcgcagtt tgttggaggg ctgctgataa gctcaggctg tgccttatac       780
     cctttaggat ggaatagccc ggagataatg caaacatgtg ggaatgtctc caatcaattt       840
     cagttaggta cctgtcggct tggctgggcc tattactgtg ctggaggtgg agcagctgca       900
     gccatgttga tctgcacctg gctctcttgc tttgctggaa gaaaccccaa gcctgtcata       960
     ttggtggaga gcatcatgag gaataccaat tcttatgcta tggagcttga ccattgcctc      1020
     aaaccttgag ctttgaaaga agattggaga gggtgggaaa ggggaggagg gagccctgaa      1080
     aagaggtact aaggattagg ccatttgtca tctgactgtc attagcatag cctagtgttt      1140
     gcatgctttt taaactaatt gtcgttcatt ttcacttatc tttaagccag taggtcactg      1200
     gctgtttata aaattcatca gaggaaacat tctcagacat ttacccaact ggcaagtcgt      1260
     gctaacccga agacccaaag taccccttta tgcaaaatag gatccaaagc taaggctggg      1320
     taagaatagt tgtgcaggga gggagcacga gatgggcaga gctggttcct accactccat      1380
     tcacacagtt catcagttca ttcccaagta tttattgtca cccccaaaca tctctggagt      1440
     actactgctc aatttttgtg tcgttatcag gagtatacct tggctcttcc tttttttctc      1500
     ctgcttcccc ccgcaccttg tggggaagct t                                     1531
//

If you have problems or comments...

PBIL Back to PBIL home page