(data stored in ACNUC681 zone)

EMBL: AK290294

ID   AK290294; SV 1; linear; mRNA; STD; HUM; 2002 BP.
XX
AC   AK290294;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ78085 complete cds.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2002
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; e0cffa92d887154e07b724caf6ba1a01.
DR   Ensembl-Gn; ENSG00000153214; homo_sapiens.
DR   Ensembl-Tr; ENST00000283206; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2002
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="CTONG2"
FT                   /clone="CTONG2002718"
FT                   /tissue_type="tongue, tumor tissue"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="tumor tissue"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        16..1680
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /db_xref="GOA:Q96K49"
FT                   /db_xref="H-InvDB:HIT000423091.6"
FT                   /db_xref="HGNC:HGNC:25913"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96K49"
FT                   /protein_id="BAF82983.1"
FT                   /translation="MVAACRSVAGLLPRRRRCFPARAPLLRVALCLLCWTPAAVRAVPE
FT                   LGLWLETVNDKSGPLIFRKTMFNSTDIKLSVKSFHCSGPVKFTIVWHLKYHTCHNEHSN
FT                   LEELFQKHKLSVDEDFCHYLKNDNCWTTKNENLDCNSDSQVFPSLNNKELINIRNVSNQ
FT                   ERSDVVARTQKDGFHIFIVSIKTENTDASWNLNVSLSMIGPHGYISASDWPLMIFYMVM
FT                   CIVYILYGILWLTWSACYWKDILRIQFWIAAVIFLGMLEKAVFYSEYQNISNTGLSTQG
FT                   LLIFAELISAIKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAVEGVMR
FT                   VIGGSNHLAVVLDDIILAVIDSIFVWFIFISLAQTMKTLRLRKNTVKFSLYRHFKNTLI
FT                   FAVLASIVFMGWTTKTFRIAKCQSDWMERWVDDAFWSFLFSLILIVIMFLWRPSANNQR
FT                   YAFMPLIDDSDDEIEEFMVTSENLTEGIKLRASKSVSNGTAKPATSENFDEDLKWVEEN
FT                   IPSSFTDVALPVLVDSDEEIMTRSEMAEKMFSSEKIM"
XX
SQ   Sequence 2002 BP; 557 A; 360 C; 446 G; 639 T; 0 other;
     agcttcctga tcaagatggt cgccgcctgc cgctcggtag ccgggctcct gccacgccgc        60
     cgccgctgct ttcccgcccg ggccccgctg ctgcgcgtcg ccctctgcct cctgtgctgg       120
     accccggcgg ctgtgcgcgc ggtccctgag ctcgggctct ggttagagac agtcaacgac       180
     aaatcaggac ctttgatatt taggaaaact atgtttaact ctacagatat caagttatct       240
     gttaagtcat tccattgttc tgggcctgtg aagtttacca tagtgtggca tttgaagtat       300
     catacctgtc acaatgagca ttctaatctg gaagagctgt tccaaaaaca taaacttagt       360
     gttgatgaag acttttgtca ttatttgaag aatgacaact gttggacaac aaaaaatgaa       420
     aacttagatt gcaacagtga ttcacaggtg tttccctctt tgaataataa agaactaata       480
     aatatcagaa atgtttcaaa ccaggaaaga tcggatgttg tagccagaac acaaaaagat       540
     gggtttcata tctttattgt ttctattaaa acggagaata cagatgcaag ctggaatttg       600
     aatgtttctc tttctatgat tgggcctcat ggatatatct ctgcatcaga ttggccccta       660
     atgatttttt acatggtgat gtgtattgtt tatatattat atggcatact ctggctgacg       720
     tggtctgcct gttattggaa agatatatta agaatccagt tctggattgc agctgttatt       780
     tttttgggaa tgcttgaaaa agcagttttt tatagtgaat accaaaacat cagcaacact       840
     ggactgtcaa cccaaggctt attgatattt gcggagttga tttctgcgat taagaggacg       900
     ttggctcgcc ttctcgtgat cattgtgagc ctgggttatg gcattgtgaa gcctcgttta       960
     ggaacagtca tgcaccgggt gatcggactg gggcttctat acttaatctt tgcagctgtt      1020
     gaaggcgtga tgagagtcat tgggggttct aaccatttag ctgttgttct tgatgacatt      1080
     attttagcag ttattgactc catttttgtg tggttcattt ttattagttt ggcacaaact      1140
     atgaagaccc taaggctaag aaagaacact gtgaaatttt cattatatag acattttaaa      1200
     aatactctga tctttgctgt gctggcttct atagtgttta tggggtggac aactaagaca      1260
     tttagaattg caaaatgcca atcagattgg atggaacgct gggttgacga tgcattttgg      1320
     agcttccttt tttcgcttat ccttattgta atcatgtttt tgtggagacc atcagcaaac      1380
     aatcagagat atgccttcat gcccttaata gatgattctg atgatgaaat tgaggaattc      1440
     atggtaactt ctgaaaattt aaccgaagga ataaaattaa gagcctcaaa atcagtttcc      1500
     aatggaacag ctaagcctgc cacttctgag aactttgatg aagatttgaa gtgggtagaa      1560
     gaaaatattc cctcttcatt cacagatgta gctcttccag tgttagtgga ttcagatgag      1620
     gaaatcatga ccagatctga aatggctgaa aaaatgttct cttcagaaaa gataatgtga      1680
     ttggaacccg tataagaaat gtagttaagc ctgaaggact atccttcatc aagactgaaa      1740
     gtgagctttg atttgatatt gcctaaaaat ttttattgtg ttatcttgga agtctgtgta      1800
     tcaaaatgaa gaattcagat ggtaggaggt tctatagtcc ttttaaagct gactcttgag      1860
     tgtcagttga atatccatta aattggattt ggaaataacc tgaggaaagt attatgataa      1920
     agatctgcac agatgcctct tagctgatag gtggcaggcc tgtgggtttg ggttctccct      1980
     cttttctctg gaacatatga ca                                               2002
//

If you have problems or comments...

PBIL Back to PBIL home page