(data stored in ACNUC27125 zone)

EMBL: AK290532

ID   AK290532; SV 1; linear; mRNA; STD; HUM; 2119 BP.
XX
AC   AK290532;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ78408 complete cds, highly similar to Homo sapiens
DE   protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
DE   (calcineurin A alpha), mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2119
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; aeafe4baa53305a2a2a3e290aa4cec7c.
DR   Ensembl-Gn; ENSG00000138814; homo_sapiens.
DR   Ensembl-Tr; ENST00000323055; homo_sapiens.
DR   Ensembl-Tr; ENST00000394853; homo_sapiens.
DR   Ensembl-Tr; ENST00000394854; homo_sapiens.
DR   Ensembl-Tr; ENST00000512215; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2119
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="FEBRA2"
FT                   /clone="FEBRA2009267"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        538..2073
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens protein phosphatase 3
FT                   (formerly 2B), catalytic subunit, alpha isoform
FT                   (calcineurin A alpha), mRNA"
FT                   /db_xref="GOA:Q08209"
FT                   /db_xref="H-InvDB:HIT000423329.6"
FT                   /db_xref="HGNC:HGNC:9314"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="PDB:1AUI"
FT                   /db_xref="PDB:1M63"
FT                   /db_xref="PDB:1MF8"
FT                   /db_xref="PDB:2JOG"
FT                   /db_xref="PDB:2JZI"
FT                   /db_xref="PDB:2P6B"
FT                   /db_xref="PDB:2R28"
FT                   /db_xref="PDB:2W73"
FT                   /db_xref="PDB:3LL8"
FT                   /db_xref="PDB:4F0Z"
FT                   /db_xref="PDB:4Q5U"
FT                   /db_xref="PDB:5C1V"
FT                   /db_xref="PDB:5SVE"
FT                   /db_xref="PDB:6NUC"
FT                   /db_xref="PDB:6NUF"
FT                   /db_xref="PDB:6NUU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08209"
FT                   /protein_id="BAF83221.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKIT
FT                   SFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ"
XX
SQ   Sequence 2119 BP; 542 A; 509 C; 559 G; 509 T; 0 other;
     agcagcggcg gccgcctctc cgccgccggg gacgccaagg tgcggctggt ggcactgaca        60
     tcggcggccc tgcctctcct ccctcgcccc cggccttccc catgtgatcg gtcttaatcc       120
     tggccgtgtg tgcgcgcgtg gggctccatt ccgcggtgct gggtctccgt gccggggtgg       180
     gtgctcgtgt gtgcgcttct cctccccatc ccccttcccc caagaataaa agaagaaccg       240
     ggaggcgtgc tcagaaaata aataaataac caccacacac gcgcagcccg gagcgagtcg       300
     gcggggctgg cggcagcggc ggaggaggag tgaaggcggc ggcggcggag gagggacgcg       360
     cggaaaaggc agcaacttta aagccagctc agagcctaga cctccagccg agcggtttgc       420
     agcgcggcgg cggcggcggc ggcggcggcg gcggcgttga gtgtctggcc cgccggtccg       480
     gtcggggtgt gcagtcggac ggacgagcag cgcgtcgctg tcctccggca gctggagatg       540
     tccgagccca aggcaattga tcccaagttg tcgacgaccg acagggtggt gaaagctgtt       600
     ccatttcctc caagtcaccg gcttacagca aaagaagtgt ttgataatga tggaaaacct       660
     cgtgtggata tcttaaaggc gcatcttatg aaggagggaa ggctggaaga gagtgttgca       720
     ttgagaataa taacagaggg tgcatcaatt cttcgacagg aaaaaaattt gctggatatt       780
     gatgcgccag tcactgtttg tggggacatt catggacaat tctttgattt gatgaagctc       840
     tttgaagtcg ggggatctcc tgccaacact cgctacctct tcttagggga ctatgttgac       900
     agagggtact tcagtattga atgtgtgctg tatttgtggg ccttgaaaat tctctacccc       960
     aaaacactgt ttttacttcg tggaaatcat gaatgtagac atctaacaga gtatttcaca      1020
     tttaaacaag aatgtaaaat aaagtattca gaacgcgtat atgatgcctg tatggatgcc      1080
     tttgactgcc ttcccctggc tgccctgatg aaccaacagt tcctgtgtgt gcatggtggt      1140
     ttgtctccag agattaacac tttagatgat atcagaaaat tagaccgatt caaagaacca      1200
     cctgcatatg gacctatgtg tgatatcctg tggtcagacc ccctggaaga ttttggaaat      1260
     gagaagactc aggaacattt cactcacaac acagtcaggg ggtgttcata cttctacagt      1320
     tacccggctg tatgtgaatt cttacagcac aataacttgt tatctatact ccgagcccac      1380
     gaagcccaag atgcagggta ccgcatgtac aggaaaagcc aaacaacagg cttcccttct      1440
     ctaattacaa ttttttcagc accaaattac ttagatgtat acaataacaa agctgcagta      1500
     ttgaagtatg agaacaatgt tatgaatatc aggcaattca actgttctcc tcatccatac      1560
     tggcttccaa atttcatgga tgtttttact tggtcccttc catttgttgg ggaaaaagtg      1620
     actgagatgc tggtaaatgt cctcaacatc tgctcagatg atgaactagg gtcagaagaa      1680
     gatggatttg atggtgcaac agctgcagcc cggaaagagg tgataaggaa caagatccga      1740
     gcaataggca aaatggccag agtgttctca gtgctcagag aagagagtga gagtgtgctg      1800
     acgctgaaag gcttgacccc aactggcatg ctccccagcg gagtactttc tggagggaag      1860
     caaaccctgc aaagcgctat caaaggattt tcaccacaac ataagatcac tagcttcgag      1920
     gaagccaagg gcttagaccg aattaatgag aggatgccgc ctcgcagaga tgccatgccc      1980
     tctgacgcca accttaactc catcaacaag gctctcacct cagagactaa cggcacggac      2040
     agcaatggca gtaatagcag caatattcag tgaccacttc ctgttcactt tttttttttt      2100
     tttttttttt tttttttga                                                   2119
//

If you have problems or comments...

PBIL Back to PBIL home page