(data stored in ACNUC8465 zone)

EMBL: AK290747

ID   AK290747; SV 1; linear; mRNA; STD; HUM; 1564 BP.
XX
AC   AK290747;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ75671 complete cds, highly similar to Homo sapiens
DE   mitogen-activated protein kinase kinase 6 (MAP2K6), transcript variant 1,
DE   mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1564
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 83464aeb2404aab9aa9bea748b7a83b0.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1564
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="IMR322"
FT                   /clone="IMR322008839"
FT                   /cell_line="IMR32"
FT                   /cell_type="neuroblastoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        301..1305
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens mitogen-activated
FT                   protein kinase kinase 6 (MAP2K6), transcript variant 1,
FT                   mRNA"
FT                   /db_xref="GOA:A8K3Y2"
FT                   /db_xref="H-InvDB:HIT000423544.6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8K3Y2"
FT                   /protein_id="BAF83436.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1564 BP; 453 A; 340 C; 364 G; 407 T; 0 other;
     actaagatac tcagttccaa gtttggagct tttagctgcc agccctggcc catcatgtag        60
     ctgcagcaca gccttcccta acgttgcaac tgggggaaaa atcactttcc agtctgtttt       120
     gcaaggtgtg catttccatc ttgattccct gaaagtccat ctgctgcatc ggtcaagaga       180
     aactccactt gcatgaagat tgcacgcctg cagcttgcat ctttgttgca aaactagcta       240
     cagaagagaa gcaaggcaaa gtcttttgtg ctcccctccc ccatcaaagg aaaggggaaa       300
     atgtctcagt cgaaaggcaa gaagcgaaac cctggcctta aaattccaaa agaagcattt       360
     gaacaacctc agaccagttc cacaccacct cgagatttag actccaaggc ttgcatttct       420
     attggaaatc agaactttga ggtgaaggca gatgacctgg agcctataat ggaactggga       480
     cgaggtgcgt acggggtggt ggagaagatg cggcacgtgc ccagcgggca gatcatggca       540
     gtgaagcgga tccgagccac agtaaatagc caggaacaga aacggctact gatggatttg       600
     gatatttcca tgaggacggt ggactgtcca ttcactgtca ccttttatgg cgcactgttt       660
     cgggagggtg atgtgtggat ctgcatggag ctcatggata catcactaga taaattctac       720
     aaacaagtta ttgataaagg ccagacaatt ccagaggaca tcttagggaa aatagcagtt       780
     tctattgtaa aagcattaga acatttacat agtaagctgt ctgtcattca cagagacgtc       840
     aagccttcta atgtactcat caatgctctc ggtcaagtga agatgtgcga ttttggaatc       900
     agtggctact tggtggactc tgttgctaaa acaattgatg caggttgcaa accatacatg       960
     gcccctgaaa gaataaaccc agagctcaac cagaagggat acagtgtgaa gtctgacatt      1020
     tggagtctgg gcatcacgat gattgagttg gccatccttc gatttcccta tgattcatgg      1080
     ggaactccat ttcagcagct caaacaggtg gtagaggagc catcgccaca actcccagca      1140
     gacaagttct ctgcagagtt tgttgacttt acctcacagt gcttaaagaa gaattccaaa      1200
     gaacggccta catacccaga gctaatgcaa catccatttt tcaccctaca tgaatccaaa      1260
     ggaacagatg tggcatcttt tgtaaaactg attcttggag actaaaaagc agtggactta      1320
     atcggttgac cctactgtgg attggtgggt ttcggggtga agcaagttca ctacagcatc      1380
     aatagaaagt catctttgag ataatttaac cctgcctctc agagggtttt ctctcccaat      1440
     tttcttttta ctccccctct taagggggcc ttggaatcta tagtatagaa tgaactgtct      1500
     agatggatga attatgataa aggcttagga cttcaaaagg tgattaaata tttaatgatg      1560
     tgtc                                                                   1564
//

If you have problems or comments...

PBIL Back to PBIL home page