(data stored in ACNUC1829 zone)

EMBL: AK291089

ID   AK291089; SV 1; linear; mRNA; STD; HUM; 1070 BP.
XX
AC   AK291089;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ76179 complete cds, highly similar to Homo sapiens
DE   transmembrane 4 superfamily member 7 (TM4SF7), mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1070
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 37bf70546d01ed18d9bea5fdb926fc5b.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1070
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RM2"
FT                   /clone="NT2RM2003098"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from uninduced NT2 neuronal precursor cells."
FT                   /db_xref="taxon:9606"
FT   CDS_pept        185..901
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens transmembrane 4
FT                   superfamily member 7 (TM4SF7), mRNA"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000423886.6"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="BAF83778.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 1070 BP; 166 A; 359 C; 331 G; 214 T; 0 other;
     ctcgtgtccg cttgactgac agctgcgcgg cgggagcggg cggcgcgagc gggaggcggc        60
     ggcgcagagc ttggggcttc cttggtcgca cccaccacct gcctgcccac tggtcagcct       120
     tcagggaccc tgagcaccgc ctggtctctt tcctgtggcc agcccaggac tgaagcgctg       180
     cggcatggcg cgcgcctgcc tccaggccgt caagtacctc atgttcgcct tcaacctgct       240
     cttctggctg ggaggctgtg gcgtgctggg tgtcggcatc tggctggccg ccacacaggg       300
     gagcttcgcc acgctgtcct cttccttccc gtccctgtcg gctgccaacc tgctcatcat       360
     caccggcgcc tttgtcatgg ccatcggctt cgtgggctgc ctgggtgcca tcaaggagaa       420
     caagtgcctc ctgctcactt tcttcctgct gctgctgctg gtgttcctgc tggaggccac       480
     catcgccatc ctcttcttcg cctacacgga caagattgac aggtatgccc agcaagacct       540
     gaagaaaggc ttgcacctgt acggcacgca gggcaacgtg ggcctcacca acgcctggag       600
     catcatccag accgacttcc gctgctgtgg cgtctccaac tacactgact ggttcgaggt       660
     gtacaacgcc acgcgggtac ctgactcctg ctgcttggag ttcagtgaga gctgtgggct       720
     gcacgccccc ggcacctggt ggaaggcgcc gtgctacgag acggtgaagg tgtggcttca       780
     ggagaacctg ctggctgtgg gcatctttgg gctgtgcacg gcgctggtgc agatcctggg       840
     cctgaccttc gccatgacca tgtactgcca agtggtcaag gcagacacct actgcgcgta       900
     ggccgcccac cgcccgcttc tctgccaaaa ggacgcccac ggggagatgg ccgcacccac       960
     agctgccttt cccaccacca gcctcggtgc tctgccccat gctgggagga gggagggagg      1020
     gacaggtgcc tggagccccc ggaaccctgt ttctggaagg ccctagctca                 1070
//

If you have problems or comments...

PBIL Back to PBIL home page