(data stored in SCRATCH zone)

EMBL: AK291761

ID   AK291761; SV 1; linear; mRNA; STD; HUM; 2854 BP.
XX
AC   AK291761;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ75497 complete cds, highly similar to Homo sapiens
DE   membrane metallo-endopeptidase (neutral endopeptidase, enkephalinase,
DE   CALLA, CD10) (MME), transcript variant 2b, mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2854
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; ace88f8a54f2694286f0ffae9adfc863.
DR   Ensembl-Gn; ENSG00000196549; homo_sapiens.
DR   Ensembl-Tr; ENST00000360490; homo_sapiens.
DR   Ensembl-Tr; ENST00000460393; homo_sapiens.
DR   Ensembl-Tr; ENST00000462745; homo_sapiens.
DR   Ensembl-Tr; ENST00000492661; homo_sapiens.
DR   Ensembl-Tr; ENST00000493237; homo_sapiens.
DR   Ensembl-Tr; ENST00000615825; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2854
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="PLACE7"
FT                   /clone="PLACE7015515"
FT                   /tissue_type="placenta"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        212..2464
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens membrane
FT                   metallo-endopeptidase (neutral endopeptidase,
FT                   enkephalinase, CALLA, CD10) (MME), transcript variant 2b,
FT                   mRNA"
FT                   /db_xref="GOA:P08473"
FT                   /db_xref="H-InvDB:HIT000424558.6"
FT                   /db_xref="HGNC:HGNC:7154"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:1DL9"
FT                   /db_xref="PDB:1DMT"
FT                   /db_xref="PDB:1QVD"
FT                   /db_xref="PDB:1R1H"
FT                   /db_xref="PDB:1R1I"
FT                   /db_xref="PDB:1R1J"
FT                   /db_xref="PDB:1Y8J"
FT                   /db_xref="PDB:2QPJ"
FT                   /db_xref="PDB:2YB9"
FT                   /db_xref="PDB:4CTH"
FT                   /db_xref="PDB:5JMY"
FT                   /db_xref="PDB:6GID"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08473"
FT                   /protein_id="BAF84450.1"
FT                   /translation="MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   GNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPD
FT                   IYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEK
FT                   EIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN
FT                   EEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
XX
SQ   Sequence 2854 BP; 919 A; 541 C; 646 G; 748 T; 0 other;
     acattcctac tgagtatgac gaatggttgt tgatggttat cactggagat tgaaaactgg        60
     gattcctttt tcaccaggaa ttggtgccta ccatggctgg ggatacacag tgatggattt       120
     gtgacttgct cctctgaaag ctggcccaag ggtgtacagc atatgaatgt gggggagttt       180
     acactacaca cgctcttggc tattttaggt gatgggcaag tcagaaagtc agatggatat       240
     aactgatatc aacactccaa agccaaagaa gaaacagcga tggactccac tggagatcag       300
     cctctcggtc cttgtcctgc tcctcaccat catagctgtg acaatgatcg cactctatgc       360
     aacctacgat gatggtattt gcaagtcatc agactgcata aaatcagctg ctcgactgat       420
     ccaaaacatg gatgccacca ctgagccttg tacagacttt ttcaaatatg cttgcggagg       480
     ctggttgaaa cgtaatgtca ttcccgagac cagctcccgt tacggcaact ttgacatttt       540
     aagagatgaa ctagaagtcg ttttgaaaga tgtccttcaa gaacccaaaa ctgaagatat       600
     agtagcagtg cagaaagcaa aagcattgta caggtcttgt ataaatgaat ctgctattga       660
     tagcagaggt ggagaacctc tactcaaact gttaccagac atatatgggt ggccagtagc       720
     aacagaaaac tgggagcaaa aatatggtgc ttcttggaca gctgaaaaag ctattgcaca       780
     actgaattct aaatatggga aaaaagtcct tattaatttg tttgttggca ctgatgataa       840
     gaattctgtg aatcatgtaa ttcatattga ccaacctcga cttggcctcc cttctagaga       900
     ttactatgaa tgcactggaa tctataaaga ggcttgtaca gcatatgtgg attttatgat       960
     ttctgtggcc agattgattc gtcaggaaga aagattgccc atcgatgaaa accagcttgc      1020
     tttggaaatg aataaagtta tggaattgga aaaagaaatt gccaatgcta cggctaaacc      1080
     tgaagatcga aatgatccaa tgcttctgta taacaagatg acattggccc agatccaaaa      1140
     taacttttca ctagagatca atgggaagcc attcagctgg ttgaatttca caaatgaaat      1200
     catgtcaact gtgaatatta gtattacaaa tgaggaagat gtggttgttt atgctccaga      1260
     atatttaacc aaacttaagc ccattcttac caaatattct gccagagatc ttcaaaattt      1320
     aatgtcctgg agattcataa tggatcttgt aagcagcctc agccgaacct acaaggagtc      1380
     cagaaatgct ttccgcaagg ccctttatgg tacaacctca gaaacagcaa cttggagacg      1440
     ttgtgcaaac tatgtcaatg ggaatatgga aaatgctgtg gggaggcttt atgtggaagc      1500
     agcatttgct ggagagagta aacatgtggt cgaggatttg attgcacaga tccgagaagt      1560
     ttttattcag actttagatg acctcacttg gatggatgcc gagacaaaaa agagagctga      1620
     agaaaaggcc ttagcaatta aagaaaggat cggctatcct gatgacattg tttcaaatga      1680
     taacaaactg aataatgagt acctcgagtt gaactacaaa gaagatgaat acttcgagaa      1740
     cataattcaa aatttgaaat tcagccaaag taaacaactg aagaagctcc gagaaaaggt      1800
     ggacaaagat gagtggataa gtggagcagc tgtagtcaat gcattttact cttcaggaag      1860
     aaatcagata gtcttcccag ccggcattct gcagcccccc ttctttagtg cccagcagtc      1920
     caactcattg aactatgggg gcatcggcat ggtcatagga cacgaaatca cccatggctt      1980
     cgatgacaat ggcagaaact ttaacaaaga tggagacctc gttgactggt ggactcaaca      2040
     gtctgcaagt aactttaagg agcaatccca gtgcatggtg tatcagtatg gaaacttttc      2100
     ctgggacctg gcaggtggac agcaccttaa tggaattaat acactgggag aaaacattgc      2160
     tgataatgga ggtcttggtc aagcatacag agcctatcag aattatatta aaaagaatgg      2220
     cgaagaaaaa ttacttcctg gacttgacct aaatcacaaa caactatttt tcttgaactt      2280
     tgcacaggtg tggtgtggaa cctataggcc agagtatgcg gttaactcca ttaaaacaga      2340
     tgtgcacagt ccaggcaatt tcaggattat tgggactttg cagaactctg cagagttttc      2400
     agaagccttt cactgccgca agaattcata catgaatcca gaaaagaagt gccgggtttg      2460
     gtgatcttca aaagaagcat tgcagccctt ggctagactt gccaacacca cagaaatggg      2520
     gaattctcta atcgaaagaa aatgggccct aggggtcact gtactgactt gagggtgatt      2580
     aacagagagg gcaccatcac aatacagata acattaggtt gtcctagaaa gggtgtggag      2640
     ggaggaaggg ggtctaaggt ctatcaagtc aatcatttct cactgtgtac ataatgctta      2700
     atttctaaag ataatattac tgtttatttc tgtttctcat atggtctacc agtttgctga      2760
     tgtccctaga aaacaatgca aaacctttga ggtagaccag gatttctaat caaaagggaa      2820
     aagaagatgt tgaagaatac agttaggcac caga                                  2854
//

If you have problems or comments...

PBIL Back to PBIL home page